Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 2819224..2819897 | Replicon | chromosome |
| Accession | NZ_CP123003 | ||
| Organism | Sinorhizobium meliloti strain BIM B-442D | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QC756_RS13885 | Protein ID | WP_010969926.1 |
| Coordinates | 2819493..2819897 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | H0GA10 |
| Locus tag | QC756_RS13880 | Protein ID | WP_003536345.1 |
| Coordinates | 2819224..2819496 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC756_RS13860 (QC756_13860) | 2815215..2816855 | - | 1641 | WP_003536336.1 | ABC transporter substrate-binding protein | - |
| QC756_RS13865 (QC756_13865) | 2816903..2817958 | - | 1056 | WP_010969924.1 | dipeptidase | - |
| QC756_RS13870 (QC756_13870) | 2818138..2818479 | - | 342 | WP_003536339.1 | SMR family transporter | - |
| QC756_RS13875 (QC756_13875) | 2818527..2819087 | - | 561 | WP_010969925.1 | TetR/AcrR family transcriptional regulator | - |
| QC756_RS13880 (QC756_13880) | 2819224..2819496 | + | 273 | WP_003536345.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QC756_RS13885 (QC756_13885) | 2819493..2819897 | + | 405 | WP_010969926.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC756_RS13890 (QC756_13890) | 2820025..2820417 | + | 393 | WP_003536349.1 | globin | - |
| QC756_RS13895 (QC756_13895) | 2820423..2820797 | + | 375 | WP_010969927.1 | DUF423 domain-containing protein | - |
| QC756_RS13900 (QC756_13900) | 2820920..2821180 | + | 261 | WP_010969928.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QC756_RS13905 (QC756_13905) | 2821295..2821609 | - | 315 | WP_003536354.1 | antibiotic biosynthesis monooxygenase | - |
| QC756_RS13910 (QC756_13910) | 2821622..2821888 | - | 267 | WP_010969929.1 | hypothetical protein | - |
| QC756_RS13915 (QC756_13915) | 2821941..2822354 | - | 414 | WP_003536357.1 | DUF2325 domain-containing protein | - |
| QC756_RS13920 (QC756_13920) | 2822562..2823488 | - | 927 | WP_010969930.1 | energy transducer TonB | - |
| QC756_RS13925 (QC756_13925) | 2823529..2823963 | - | 435 | WP_010969931.1 | hypothetical protein | - |
| QC756_RS13930 (QC756_13930) | 2824193..2824333 | + | 141 | WP_010969932.1 | hemin uptake protein HemP | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14747.98 Da Isoelectric Point: 5.1974
>T278336 WP_010969926.1 NZ_CP123003:2819493-2819897 [Sinorhizobium meliloti]
MNGYLLDTNIISDVIHNPFGPAAQRIERIGPKEIYTSIVVASELRYGCAKKGSAKLLAKVESLLEIVPVLPLDIPADTRY
GSIRAELESLGQTIGSNDLLIAAHAYALDLTLVTDNIREFSRVRGLSLENWLER
MNGYLLDTNIISDVIHNPFGPAAQRIERIGPKEIYTSIVVASELRYGCAKKGSAKLLAKVESLLEIVPVLPLDIPADTRY
GSIRAELESLGQTIGSNDLLIAAHAYALDLTLVTDNIREFSRVRGLSLENWLER
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|