Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65376..65792 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122874 | ||
| Organism | Escherichia coli strain ETEC1718 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDX06_RS26230 | Protein ID | WP_247141765.1 |
| Coordinates | 65670..65792 (+) | Length | 41 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 65376..65585 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX06_RS26195 | 61060..61593 | + | 534 | WP_032085149.1 | single-stranded DNA-binding protein | - |
| QDX06_RS26200 | 61651..61884 | + | 234 | WP_032085150.1 | DUF905 family protein | - |
| QDX06_RS26205 | 61950..63908 | + | 1959 | WP_089637074.1 | ParB/RepB/Spo0J family partition protein | - |
| QDX06_RS26210 | 63963..64397 | + | 435 | Protein_70 | conjugation system SOS inhibitor PsiB | - |
| QDX06_RS26215 | 64394..65113 | + | 720 | WP_032085152.1 | plasmid SOS inhibition protein A | - |
| QDX06_RS26220 | 65110..65424 | + | 315 | WP_089637073.1 | theronine dehydrogenase | - |
| - | 65373..65585 | + | 213 | NuclAT_0 | - | - |
| - | 65373..65585 | + | 213 | NuclAT_0 | - | - |
| - | 65373..65585 | + | 213 | NuclAT_0 | - | - |
| - | 65373..65585 | + | 213 | NuclAT_0 | - | - |
| - | 65376..65585 | - | 210 | - | - | Antitoxin |
| QDX06_RS26225 | 65573..65725 | + | 153 | Protein_73 | DUF5431 family protein | - |
| QDX06_RS26230 | 65670..65792 | + | 123 | WP_247141765.1 | Hok/Gef family protein | Toxin |
| QDX06_RS26235 | 66149..66799 | + | 651 | WP_000993931.1 | IS66-like element accessory protein TnpA | - |
| QDX06_RS26240 | 66799..67146 | + | 348 | WP_213833996.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX06_RS26245 | 67242..68309 | + | 1068 | Protein_77 | IS66-like element ISCro1 family transposase | - |
| QDX06_RS26250 | 68431..68643 | - | 213 | WP_032084501.1 | hypothetical protein | - |
| QDX06_RS26255 | 68776..69336 | - | 561 | WP_001523482.1 | fertility inhibition protein FinO | - |
| QDX06_RS26260 | 69391..70137 | - | 747 | WP_001523483.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..102370 | 102370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4562.36 Da Isoelectric Point: 8.2774
>T278152 WP_247141765.1 NZ_CP122874:65670-65792 [Escherichia coli]
IVCCTLLIFTHLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTHLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
Antitoxin
Download Length: 210 bp
>AT278152 NZ_CP122874:c65585-65376 [Escherichia coli]
GTGGACTAGACATGCAGAGGCCTCGTGGGTTAATGAAAATTAACTACGGGGCTTTTGTCCTTCTGCCACACGACAGGATA
ACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGCTGACCACA
TTCACTTTCCCTGAAAATAATCCGGTCGTTCAGCCAGTTCACGGGCAATC
GTGGACTAGACATGCAGAGGCCTCGTGGGTTAATGAAAATTAACTACGGGGCTTTTGTCCTTCTGCCACACGACAGGATA
ACAAACCACCTTCACGTCATGAGGCAGAAAGCCTCAAGCGCCGGGCACATCATAGCCCATATACCTGCACGCTGACCACA
TTCACTTTCCCTGAAAATAATCCGGTCGTTCAGCCAGTTCACGGGCAATC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|