Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4052996..4053831 Replicon chromosome
Accession NZ_CP122859
Organism Escherichia coli strain ETEC1720

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag QDY31_RS19930 Protein ID WP_126697185.1
Coordinates 4052996..4053373 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag QDY31_RS19935 Protein ID WP_021542768.1
Coordinates 4053463..4053831 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY31_RS19890 (4048244) 4048244..4049317 + 1074 WP_069936650.1 N-acetylneuraminate epimerase -
QDY31_RS19895 (4049382) 4049382..4050362 + 981 WP_001295601.1 sialate O-acetylesterase -
QDY31_RS19900 (4050370) 4050370..4051020 - 651 WP_001037966.1 HNH endonuclease -
QDY31_RS19905 (4051157) 4051157..4051300 + 144 Protein_3894 HNH endonuclease -
QDY31_RS19910 (4051366) 4051366..4051584 + 219 WP_001135362.1 hypothetical protein -
QDY31_RS19915 (4052068) 4052068..4052217 - 150 Protein_3896 restriction endonuclease subunit M -
QDY31_RS19920 (4052302) 4052302..4052499 - 198 WP_000839281.1 DUF957 domain-containing protein -
QDY31_RS19925 (4052511) 4052511..4052999 - 489 WP_196010886.1 DUF5983 family protein -
QDY31_RS19930 (4052996) 4052996..4053373 - 378 WP_126697185.1 TA system toxin CbtA family protein Toxin
QDY31_RS19935 (4053463) 4053463..4053831 - 369 WP_021542768.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDY31_RS19940 (4053994) 4053994..4054215 - 222 WP_000692345.1 DUF987 domain-containing protein -
QDY31_RS19945 (4054278) 4054278..4054754 - 477 WP_001186746.1 RadC family protein -
QDY31_RS19950 (4054770) 4054770..4055255 - 486 WP_000849588.1 antirestriction protein -
QDY31_RS19955 (4055310) 4055310..4056128 - 819 WP_001234620.1 DUF932 domain-containing protein -
QDY31_RS19960 (4056228) 4056228..4056461 - 234 WP_001119729.1 DUF905 family protein -
QDY31_RS19965 (4056540) 4056540..4056995 - 456 WP_000581504.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - fimH / fimG / fimF / fimD / fimC / fimI / fimA / fimE / fimB 4035150..4068515 33365


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14063.98 Da        Isoelectric Point: 7.2919

>T278095 WP_126697185.1 NZ_CP122859:c4053373-4052996 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13573.33 Da        Isoelectric Point: 6.4789

>AT278095 WP_021542768.1 NZ_CP122859:c4053831-4053463 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWRLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References