Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 584050..584849 | Replicon | chromosome |
Accession | NZ_CP122844 | ||
Organism | Escherichia coli strain ETEC1722 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | QDX00_RS02885 | Protein ID | WP_000347273.1 |
Coordinates | 584050..584514 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDX00_RS02890 | Protein ID | WP_001307405.1 |
Coordinates | 584514..584849 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX00_RS02855 (579051) | 579051..579485 | - | 435 | WP_000948842.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDX00_RS02860 (579503) | 579503..580381 | - | 879 | WP_094314169.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDX00_RS02865 (580371) | 580371..581150 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDX00_RS02870 (581161) | 581161..581634 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDX00_RS02875 (581657) | 581657..582937 | - | 1281 | WP_196011018.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDX00_RS02880 (583186) | 583186..583995 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
QDX00_RS02885 (584050) | 584050..584514 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDX00_RS02890 (584514) | 584514..584849 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDX00_RS02895 (584998) | 584998..586569 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
QDX00_RS02900 (586944) | 586944..588278 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDX00_RS02905 (588294) | 588294..589064 | + | 771 | WP_196011017.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T278050 WP_000347273.1 NZ_CP122844:c584514-584050 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |