Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 49192..50024 | Replicon | chromosome |
Accession | NZ_CP122727 | ||
Organism | Escherichia coli strain ETEC1746 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | QDW99_RS00255 | Protein ID | WP_000854753.1 |
Coordinates | 49192..49566 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | Q5I3J0 |
Locus tag | QDW99_RS00260 | Protein ID | WP_001280951.1 |
Coordinates | 49656..50024 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW99_RS00225 (44558) | 44558..45481 | - | 924 | WP_000535963.1 | carboxylate/amino acid/amine transporter | - |
QDW99_RS00230 (45592) | 45592..46776 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
QDW99_RS00235 (47173) | 47173..47334 | - | 162 | Protein_46 | RhuM family protein | - |
QDW99_RS00240 (47568) | 47568..48413 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
QDW99_RS00245 (48498) | 48498..48695 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
QDW99_RS00250 (48707) | 48707..49195 | - | 489 | WP_001549830.1 | DUF5983 family protein | - |
QDW99_RS00255 (49192) | 49192..49566 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
QDW99_RS00260 (49656) | 49656..50024 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW99_RS00265 (50187) | 50187..50408 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
QDW99_RS00270 (50477) | 50477..50953 | - | 477 | WP_033566565.1 | RadC family protein | - |
QDW99_RS00275 (50969) | 50969..51454 | - | 486 | WP_001469549.1 | antirestriction protein | - |
QDW99_RS00280 (51509) | 51509..52327 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
QDW99_RS00285 (52427) | 52427..52660 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
QDW99_RS00290 (52739) | 52739..53195 | - | 457 | Protein_57 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T277807 WP_000854753.1 NZ_CP122727:c49566-49192 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q5I3J0 |