Detailed information of TA system TA277747

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73423..73844
• Replicon: plasmid unnamed5
• Accession: NZ_CP122717
• Organism: Escherichia coli strain ETEC1749

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDX02_RS27935
• Protein ID: WP_096937776.1
• Coordinates: 73719..73844 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	73423..73621 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDX02_RS27895 (68622)	68622..69048	-	427	Protein_81	hypothetical protein	-
QDX02_RS27900 (69118)	69118..69324	+	207	WP_187771926.1	single-stranded DNA-binding protein	-
QDX02_RS27905 (69350)	69350..69889	+	540	WP_000290811.1	single-stranded DNA-binding protein	-
QDX02_RS27910 (69951)	69951..70184	+	234	WP_000005985.1	DUF905 family protein	-
QDX02_RS27915 (70248)	70248..72206	+	1959	WP_000117204.1	ParB/RepB/Spo0J family partition protein	-
QDX02_RS27920 (72261)	72261..72695	+	435	WP_000845915.1	conjugation system SOS inhibitor PsiB	-
QDX02_RS27925 (72692)	72692..73478	+	787	Protein_87	plasmid SOS inhibition protein A	-
- (73423)	73423..73621	+	199	NuclAT_0	-	Antitoxin
- (73423)	73423..73621	+	199	NuclAT_0	-	Antitoxin
- (73423)	73423..73621	+	199	NuclAT_0	-	Antitoxin
- (73423)	73423..73621	+	199	NuclAT_0	-	Antitoxin
QDX02_RS27930 (73628)	73628..73777	+	150	Protein_88	DUF5431 family protein	-
QDX02_RS27935 (73719)	73719..73844	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDX02_RS27940 (74145)	74145..74331	-	187	Protein_90	pilus protein	-
QDX02_RS27945 (74391)	74391..74678	+	288	WP_000107541.1	hypothetical protein	-
QDX02_RS27950 (74796)	74796..75617	+	822	WP_001424949.1	DUF932 domain-containing protein	-
QDX02_RS27955 (75913)	75913..76515	-	603	WP_077632063.1	transglycosylase SLT domain-containing protein	-
QDX02_RS27960 (76837)	76837..77220	+	384	WP_001151534.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDX02_RS27965 (77411)	77411..78058	+	648	WP_000332521.1	conjugal transfer transcriptional regulator TraJ	-
QDX02_RS27970 (78194)	78194..78409	+	216	WP_071782156.1	conjugal transfer relaxosome protein TraY	-
QDX02_RS27975 (78453)	78453..78818	+	366	WP_000338819.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA	1..96635	96635

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T277747 WP_096937776.1 NZ_CP122717:73719-73844 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT277747 NZ_CP122717:73423-73621 [Escherichia coli]
TCACACGGATTGCCCGTGAACTGGCTGAACGACCAGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin