Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 65134..65403 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122714 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDX02_RS27385 | Protein ID | WP_096937776.1 |
| Coordinates | 65278..65403 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 65134..65199 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS27350 (60897) | 60897..61424 | + | 528 | WP_000290797.1 | single-stranded DNA-binding protein | - |
| QDX02_RS27355 (61482) | 61482..61715 | + | 234 | WP_000006015.1 | DUF905 family protein | - |
| QDX02_RS27360 (61779) | 61779..63746 | + | 1968 | WP_000117157.1 | ParB/RepB/Spo0J family partition protein | - |
| QDX02_RS27365 (63815) | 63815..64249 | + | 435 | WP_000845915.1 | conjugation system SOS inhibitor PsiB | - |
| QDX02_RS27370 (64246) | 64246..65032 | + | 787 | Protein_69 | plasmid SOS inhibition protein A | - |
| QDX02_RS27375 (64977) | 64977..65165 | - | 189 | WP_032189914.1 | hypothetical protein | - |
| - (65134) | 65134..65199 | + | 66 | NuclAT_1 | - | - |
| - (65134) | 65134..65199 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (64977) | 64977..65201 | + | 225 | NuclAT_0 | - | - |
| - (64977) | 64977..65201 | + | 225 | NuclAT_0 | - | - |
| - (64977) | 64977..65201 | + | 225 | NuclAT_0 | - | - |
| - (64977) | 64977..65201 | + | 225 | NuclAT_0 | - | - |
| - (64977) | 64977..65201 | - | 225 | NuclAT_0 | - | - |
| QDX02_RS27380 (65187) | 65187..65336 | + | 150 | Protein_71 | plasmid maintenance protein Mok | - |
| QDX02_RS27385 (65278) | 65278..65403 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDX02_RS27390 (65768) | 65768..67339 | - | 1572 | WP_000381443.1 | IS66 family transposase | - |
| QDX02_RS27395 (67359) | 67359..67706 | - | 348 | WP_000624618.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX02_RS27400 (67706) | 67706..68356 | - | 651 | WP_000993956.1 | IS66-like element accessory protein TnpA | - |
| QDX02_RS27405 (68463) | 68463..68683 | - | 221 | Protein_76 | hypothetical protein | - |
| QDX02_RS27410 (68824) | 68824..69501 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| QDX02_RS27415 (69501) | 69501..69848 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T277744 WP_096937776.1 NZ_CP122714:65278-65403 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT277744 NZ_CP122714:c65199-65134 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|