Detailed information of TA system TA277743

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 64977..65403
• Replicon: plasmid unnamed2
• Accession: NZ_CP122714
• Organism: Escherichia coli strain ETEC1749

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDX02_RS27385
• Protein ID: WP_096937776.1
• Coordinates: 65278..65403 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	64977..65201 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDX02_RS27345 (60126)	60126..60595	-	470	Protein_64	hypothetical protein	-
QDX02_RS27350 (60897)	60897..61424	+	528	WP_000290797.1	single-stranded DNA-binding protein	-
QDX02_RS27355 (61482)	61482..61715	+	234	WP_000006015.1	DUF905 family protein	-
QDX02_RS27360 (61779)	61779..63746	+	1968	WP_000117157.1	ParB/RepB/Spo0J family partition protein	-
QDX02_RS27365 (63815)	63815..64249	+	435	WP_000845915.1	conjugation system SOS inhibitor PsiB	-
QDX02_RS27370 (64246)	64246..65032	+	787	Protein_69	plasmid SOS inhibition protein A	-
QDX02_RS27375 (64977)	64977..65165	-	189	WP_032189914.1	hypothetical protein	-
- (65134)	65134..65199	+	66	NuclAT_1	-	-
- (65134)	65134..65199	-	66	NuclAT_0	-	-
- (64977)	64977..65201	+	225	NuclAT_0	-	Antitoxin
- (64977)	64977..65201	+	225	NuclAT_0	-	Antitoxin
- (64977)	64977..65201	+	225	NuclAT_0	-	Antitoxin
- (64977)	64977..65201	+	225	NuclAT_0	-	Antitoxin
- (64977)	64977..65201	-	225	NuclAT_0	-	-
QDX02_RS27380 (65187)	65187..65336	+	150	Protein_71	plasmid maintenance protein Mok	-
QDX02_RS27385 (65278)	65278..65403	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDX02_RS27390 (65768)	65768..67339	-	1572	WP_000381443.1	IS66 family transposase	-
QDX02_RS27395 (67359)	67359..67706	-	348	WP_000624618.1	IS66 family insertion sequence element accessory protein TnpB	-
QDX02_RS27400 (67706)	67706..68356	-	651	WP_000993956.1	IS66-like element accessory protein TnpA	-
QDX02_RS27405 (68463)	68463..68683	-	221	Protein_76	hypothetical protein	-
QDX02_RS27410 (68824)	68824..69501	+	678	WP_001339397.1	IS66-like element accessory protein TnpA	-
QDX02_RS27415 (69501)	69501..69848	+	348	WP_000624622.1	IS66 family insertion sequence element accessory protein TnpB	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T277743 WP_096937776.1 NZ_CP122714:65278-65403 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT277743 NZ_CP122714:64977-65201 [Escherichia coli]
TCACACGGATTGCCCGTGAACTGGCTGAACGACCAGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin