Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2262394..2262614 Replicon chromosome
Accession NZ_CP122712
Organism Escherichia coli strain ETEC1749

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QDX02_RS11385 Protein ID WP_000170965.1
Coordinates 2262394..2262501 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2262548..2262614 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX02_RS11355 2258252..2259085 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
QDX02_RS11360 2259082..2259474 + 393 WP_000200373.1 invasion regulator SirB2 -
QDX02_RS11365 2259478..2260287 + 810 WP_001257044.1 invasion regulator SirB1 -
QDX02_RS11370 2260323..2261177 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QDX02_RS11375 2261324..2261431 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2261479..2261545 + 67 NuclAT_12 - -
- 2261479..2261545 + 67 NuclAT_12 - -
- 2261479..2261545 + 67 NuclAT_12 - -
- 2261479..2261545 + 67 NuclAT_12 - -
- 2261479..2261545 + 67 NuclAT_14 - -
- 2261479..2261545 + 67 NuclAT_14 - -
- 2261479..2261545 + 67 NuclAT_14 - -
- 2261479..2261545 + 67 NuclAT_14 - -
- 2261479..2261545 + 67 NuclAT_16 - -
- 2261479..2261545 + 67 NuclAT_16 - -
- 2261479..2261545 + 67 NuclAT_16 - -
- 2261479..2261545 + 67 NuclAT_16 - -
- 2261479..2261545 + 67 NuclAT_18 - -
- 2261479..2261545 + 67 NuclAT_18 - -
- 2261479..2261545 + 67 NuclAT_18 - -
- 2261479..2261545 + 67 NuclAT_18 - -
- 2261479..2261545 + 67 NuclAT_20 - -
- 2261479..2261545 + 67 NuclAT_20 - -
- 2261479..2261545 + 67 NuclAT_20 - -
- 2261479..2261545 + 67 NuclAT_20 - -
- 2261479..2261545 + 67 NuclAT_22 - -
- 2261479..2261545 + 67 NuclAT_22 - -
- 2261479..2261545 + 67 NuclAT_22 - -
- 2261479..2261545 + 67 NuclAT_22 - -
- 2261481..2261544 + 64 NuclAT_27 - -
- 2261481..2261544 + 64 NuclAT_27 - -
- 2261481..2261544 + 64 NuclAT_27 - -
- 2261481..2261544 + 64 NuclAT_27 - -
- 2261481..2261544 + 64 NuclAT_30 - -
- 2261481..2261544 + 64 NuclAT_30 - -
- 2261481..2261544 + 64 NuclAT_30 - -
- 2261481..2261544 + 64 NuclAT_30 - -
- 2261481..2261544 + 64 NuclAT_33 - -
- 2261481..2261544 + 64 NuclAT_33 - -
- 2261481..2261544 + 64 NuclAT_33 - -
- 2261481..2261544 + 64 NuclAT_33 - -
- 2261481..2261544 + 64 NuclAT_36 - -
- 2261481..2261544 + 64 NuclAT_36 - -
- 2261481..2261544 + 64 NuclAT_36 - -
- 2261481..2261544 + 64 NuclAT_36 - -
- 2261481..2261544 + 64 NuclAT_40 - -
- 2261481..2261544 + 64 NuclAT_40 - -
- 2261481..2261544 + 64 NuclAT_40 - -
- 2261481..2261544 + 64 NuclAT_40 - -
- 2261481..2261544 + 64 NuclAT_43 - -
- 2261481..2261544 + 64 NuclAT_43 - -
- 2261481..2261544 + 64 NuclAT_43 - -
- 2261481..2261544 + 64 NuclAT_43 - -
- 2261481..2261546 + 66 NuclAT_46 - -
- 2261481..2261546 + 66 NuclAT_46 - -
- 2261481..2261546 + 66 NuclAT_46 - -
- 2261481..2261546 + 66 NuclAT_46 - -
QDX02_RS11380 2261859..2261966 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2262014..2262079 + 66 NuclAT_25 - -
- 2262014..2262079 + 66 NuclAT_25 - -
- 2262014..2262079 + 66 NuclAT_25 - -
- 2262014..2262079 + 66 NuclAT_25 - -
- 2262014..2262079 + 66 NuclAT_28 - -
- 2262014..2262079 + 66 NuclAT_28 - -
- 2262014..2262079 + 66 NuclAT_28 - -
- 2262014..2262079 + 66 NuclAT_28 - -
- 2262014..2262079 + 66 NuclAT_31 - -
- 2262014..2262079 + 66 NuclAT_31 - -
- 2262014..2262079 + 66 NuclAT_31 - -
- 2262014..2262079 + 66 NuclAT_31 - -
- 2262014..2262079 + 66 NuclAT_34 - -
- 2262014..2262079 + 66 NuclAT_34 - -
- 2262014..2262079 + 66 NuclAT_34 - -
- 2262014..2262079 + 66 NuclAT_34 - -
- 2262014..2262079 + 66 NuclAT_38 - -
- 2262014..2262079 + 66 NuclAT_38 - -
- 2262014..2262079 + 66 NuclAT_38 - -
- 2262014..2262079 + 66 NuclAT_38 - -
- 2262014..2262079 + 66 NuclAT_41 - -
- 2262014..2262079 + 66 NuclAT_41 - -
- 2262014..2262079 + 66 NuclAT_41 - -
- 2262014..2262079 + 66 NuclAT_41 - -
- 2262014..2262081 + 68 NuclAT_44 - -
- 2262014..2262081 + 68 NuclAT_44 - -
- 2262014..2262081 + 68 NuclAT_44 - -
- 2262014..2262081 + 68 NuclAT_44 - -
- 2262015..2262080 + 66 NuclAT_13 - -
- 2262015..2262080 + 66 NuclAT_13 - -
- 2262015..2262080 + 66 NuclAT_13 - -
- 2262015..2262080 + 66 NuclAT_13 - -
- 2262015..2262080 + 66 NuclAT_15 - -
- 2262015..2262080 + 66 NuclAT_15 - -
- 2262015..2262080 + 66 NuclAT_15 - -
- 2262015..2262080 + 66 NuclAT_15 - -
- 2262015..2262080 + 66 NuclAT_17 - -
- 2262015..2262080 + 66 NuclAT_17 - -
- 2262015..2262080 + 66 NuclAT_17 - -
- 2262015..2262080 + 66 NuclAT_17 - -
- 2262015..2262080 + 66 NuclAT_19 - -
- 2262015..2262080 + 66 NuclAT_19 - -
- 2262015..2262080 + 66 NuclAT_19 - -
- 2262015..2262080 + 66 NuclAT_19 - -
- 2262015..2262080 + 66 NuclAT_21 - -
- 2262015..2262080 + 66 NuclAT_21 - -
- 2262015..2262080 + 66 NuclAT_21 - -
- 2262015..2262080 + 66 NuclAT_21 - -
- 2262015..2262080 + 66 NuclAT_23 - -
- 2262015..2262080 + 66 NuclAT_23 - -
- 2262015..2262080 + 66 NuclAT_23 - -
- 2262015..2262080 + 66 NuclAT_23 - -
QDX02_RS11385 2262394..2262501 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2262548..2262614 + 67 - - Antitoxin
QDX02_RS11390 2262906..2264006 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
QDX02_RS11395 2264276..2264506 + 231 WP_282842663.1 putative cation transport regulator ChaB -
QDX02_RS11400 2264664..2265359 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QDX02_RS11405 2265403..2265756 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QDX02_RS11410 2265942..2267336 + 1395 WP_001400233.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T277729 WP_000170965.1 NZ_CP122712:c2262501-2262394 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT277729 NZ_CP122712:2262548-2262614 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCTGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References