Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 2261324..2261545 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | QDX02_RS11375 | Protein ID | WP_000170951.1 |
| Coordinates | 2261324..2261431 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2261479..2261545 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS11350 (2257170) | 2257170..2258252 | + | 1083 | WP_000804723.1 | peptide chain release factor 1 | - |
| QDX02_RS11355 (2258252) | 2258252..2259085 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| QDX02_RS11360 (2259082) | 2259082..2259474 | + | 393 | WP_000200373.1 | invasion regulator SirB2 | - |
| QDX02_RS11365 (2259478) | 2259478..2260287 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| QDX02_RS11370 (2260323) | 2260323..2261177 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| QDX02_RS11375 (2261324) | 2261324..2261431 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_27 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_27 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_27 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_27 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_30 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_30 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_30 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_30 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_33 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_33 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_33 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_33 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_36 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_36 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_36 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_36 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_40 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_40 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_40 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_40 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_43 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_43 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_43 | - | - |
| - (2261481) | 2261481..2261544 | + | 64 | NuclAT_43 | - | - |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_14 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_14 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_14 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_14 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_16 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_18 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_18 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_18 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_18 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_20 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_20 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_20 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_20 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (2261479) | 2261479..2261545 | + | 67 | NuclAT_22 | - | Antitoxin |
| - (2261481) | 2261481..2261546 | + | 66 | NuclAT_46 | - | - |
| - (2261481) | 2261481..2261546 | + | 66 | NuclAT_46 | - | - |
| - (2261481) | 2261481..2261546 | + | 66 | NuclAT_46 | - | - |
| - (2261481) | 2261481..2261546 | + | 66 | NuclAT_46 | - | - |
| QDX02_RS11380 (2261859) | 2261859..2261966 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_25 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_25 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_25 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_25 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_28 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_28 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_28 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_28 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_31 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_31 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_31 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_31 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_34 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_34 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_34 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_34 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_38 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_38 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_38 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_38 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_41 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_41 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_41 | - | - |
| - (2262014) | 2262014..2262079 | + | 66 | NuclAT_41 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_13 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_13 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_13 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_13 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_15 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_15 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_15 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_15 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_17 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_17 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_17 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_17 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_19 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_19 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_19 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_19 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_21 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_21 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_21 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_21 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_23 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_23 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_23 | - | - |
| - (2262015) | 2262015..2262080 | + | 66 | NuclAT_23 | - | - |
| - (2262014) | 2262014..2262081 | + | 68 | NuclAT_44 | - | - |
| - (2262014) | 2262014..2262081 | + | 68 | NuclAT_44 | - | - |
| - (2262014) | 2262014..2262081 | + | 68 | NuclAT_44 | - | - |
| - (2262014) | 2262014..2262081 | + | 68 | NuclAT_44 | - | - |
| QDX02_RS11385 (2262394) | 2262394..2262501 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_26 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_26 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_26 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_26 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_29 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_29 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_29 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_29 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_32 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_32 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_32 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_32 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_35 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_35 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_35 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_35 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_39 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_39 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_39 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_39 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_42 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_42 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_42 | - | - |
| - (2262549) | 2262549..2262614 | + | 66 | NuclAT_42 | - | - |
| - (2262549) | 2262549..2262616 | + | 68 | NuclAT_45 | - | - |
| - (2262549) | 2262549..2262616 | + | 68 | NuclAT_45 | - | - |
| - (2262549) | 2262549..2262616 | + | 68 | NuclAT_45 | - | - |
| - (2262549) | 2262549..2262616 | + | 68 | NuclAT_45 | - | - |
| QDX02_RS11390 (2262906) | 2262906..2264006 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| QDX02_RS11395 (2264276) | 2264276..2264506 | + | 231 | WP_282842663.1 | putative cation transport regulator ChaB | - |
| QDX02_RS11400 (2264664) | 2264664..2265359 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| QDX02_RS11405 (2265403) | 2265403..2265756 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T277725 WP_000170951.1 NZ_CP122712:c2261431-2261324 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT277725 NZ_CP122712:2261479-2261545 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|