Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 743522..744357 | Replicon | chromosome |
| Accession | NZ_CP122712 | ||
| Organism | Escherichia coli strain ETEC1749 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8S7S8K0 |
| Locus tag | QDX02_RS03635 | Protein ID | WP_000854723.1 |
| Coordinates | 743980..744357 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8S7S6L8 |
| Locus tag | QDX02_RS03630 | Protein ID | WP_001285573.1 |
| Coordinates | 743522..743890 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX02_RS03610 (741238) | 741238..742056 | + | 819 | WP_032167344.1 | DUF932 domain-containing protein | - |
| QDX02_RS03615 (742148) | 742148..742642 | + | 495 | WP_032167345.1 | antirestriction protein | - |
| QDX02_RS03620 (742658) | 742658..743134 | + | 477 | WP_001360063.1 | RadC family protein | - |
| QDX02_RS03625 (743221) | 743221..743442 | + | 222 | WP_000692176.1 | DUF987 domain-containing protein | - |
| QDX02_RS03630 (743522) | 743522..743890 | + | 369 | WP_001285573.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDX02_RS03635 (743980) | 743980..744357 | + | 378 | WP_000854723.1 | TA system toxin CbtA family protein | Toxin |
| QDX02_RS03640 (744354) | 744354..744842 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
| QDX02_RS03645 (744854) | 744854..745051 | + | 198 | WP_000772035.1 | DUF957 domain-containing protein | - |
| QDX02_RS03650 (745148) | 745148..745993 | + | 846 | WP_001290254.1 | DUF4942 domain-containing protein | - |
| QDX02_RS03660 (746727) | 746727..748979 | + | 2253 | Protein_718 | alpha-amylase family glycosyl hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14145.23 Da Isoelectric Point: 8.2904
>T277718 WP_000854723.1 NZ_CP122712:743980-744357 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRTRRATGLMARDNYRTVNNIILGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRTRRATGLMARDNYRTVNNIILGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|