Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 793820..794655 Replicon chromosome
Accession NZ_CP122660
Organism Escherichia coli strain ETEC4073

Toxin (Protein)


Gene name yeeV Uniprot ID A0A7W4PV54
Locus tag QDY26_RS03870 Protein ID WP_000854821.1
Coordinates 793820..794197 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag QDY26_RS03875 Protein ID WP_001285610.1
Coordinates 794287..794655 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY26_RS03835 (788901) 788901..789500 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
QDY26_RS03840 (789503) 789503..790480 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
QDY26_RS03845 (790477) 790477..791655 + 1179 WP_000094991.1 type II secretion system protein GspL -
QDY26_RS03850 (791657) 791657..792193 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
QDY26_RS03855 (792474) 792474..793316 - 843 WP_001280493.1 DUF4942 domain-containing protein -
QDY26_RS03860 (793401) 793401..793598 - 198 WP_236495935.1 hypothetical protein -
QDY26_RS03865 (793626) 793626..793823 - 198 Protein_758 DUF5983 family protein -
QDY26_RS03870 (793820) 793820..794197 - 378 WP_000854821.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QDY26_RS03875 (794287) 794287..794655 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QDY26_RS03880 (794735) 794735..794956 - 222 WP_000692350.1 DUF987 domain-containing protein -
QDY26_RS03885 (795043) 795043..795519 - 477 WP_001384108.1 RadC family protein -
QDY26_RS03890 (795535) 795535..796017 - 483 WP_000206657.1 antirestriction protein -
QDY26_RS03895 (796109) 796109..796927 - 819 WP_001175136.1 DUF932 domain-containing protein -
QDY26_RS03900 (797017) 797017..797250 - 234 WP_001117568.1 DUF905 family protein -
QDY26_RS03905 (797321) 797321..797617 - 297 Protein_766 autotransporter domain-containing protein -
QDY26_RS03910 (797615) 797615..797851 - 237 Protein_767 50S ribosome-binding GTPase -
QDY26_RS03915 (797935) 797935..798957 - 1023 WP_236495919.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13930.95 Da        Isoelectric Point: 8.5163

>T277576 WP_000854821.1 NZ_CP122660:c794197-793820 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT277576 WP_001285610.1 NZ_CP122660:c794655-794287 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W4PV54

Antitoxin

Source ID Structure

References