Detailed information of TA system TA277571

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2817..3086
• Replicon: plasmid unnamed2
• Accession: NZ_CP122657
• Organism: Escherichia coli strain ETEC4074

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QDW60_RS24790
• Protein ID: WP_001372321.1
• Coordinates: 2961..3086 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	2817..2882 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QDW60_RS24770	1498..1932	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QDW60_RS24775	1929..2691	+	763	Protein_2	plasmid SOS inhibition protein A	-
QDW60_RS24780	2660..2848	-	189	WP_032084246.1	hypothetical protein	-
-	2660..2884	+	225	NuclAT_0	-	-
-	2660..2884	+	225	NuclAT_0	-	-
-	2660..2884	+	225	NuclAT_0	-	-
-	2660..2884	+	225	NuclAT_0	-	-
-	2817..2882	-	66	-	-	Antitoxin
QDW60_RS24785	2870..3019	+	150	Protein_4	plasmid maintenance protein Mok	-
QDW60_RS24790	2961..3086	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QDW60_RS24795	3306..3536	+	231	WP_074014914.1	hypothetical protein	-
QDW60_RS24800	3534..3707	-	174	Protein_7	hypothetical protein	-
QDW60_RS24805	3777..3983	+	207	WP_000547968.1	hypothetical protein	-
QDW60_RS24810	4008..4294	+	287	Protein_9	hypothetical protein	-
QDW60_RS24815	4413..5234	+	822	WP_074014913.1	DUF932 domain-containing protein	-
QDW60_RS24820	5531..6178	-	648	WP_282953962.1	transglycosylase SLT domain-containing protein	-
QDW60_RS24825	6455..6838	+	384	WP_040073112.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QDW60_RS24830	7028..7714	+	687	WP_000332492.1	PAS domain-containing protein	-
QDW60_RS24835	7808..8035	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	estIa	1..83893	83893

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277571 WP_001372321.1 NZ_CP122657:2961-3086 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT277571 NZ_CP122657:c2882-2817 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin