Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2817..3086 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122657 | ||
| Organism | Escherichia coli strain ETEC4074 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QDW60_RS24790 | Protein ID | WP_001372321.1 |
| Coordinates | 2961..3086 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 2817..2882 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW60_RS24770 | 1498..1932 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QDW60_RS24775 | 1929..2691 | + | 763 | Protein_2 | plasmid SOS inhibition protein A | - |
| QDW60_RS24780 | 2660..2848 | - | 189 | WP_032084246.1 | hypothetical protein | - |
| - | 2660..2884 | + | 225 | NuclAT_0 | - | - |
| - | 2660..2884 | + | 225 | NuclAT_0 | - | - |
| - | 2660..2884 | + | 225 | NuclAT_0 | - | - |
| - | 2660..2884 | + | 225 | NuclAT_0 | - | - |
| - | 2817..2882 | - | 66 | - | - | Antitoxin |
| QDW60_RS24785 | 2870..3019 | + | 150 | Protein_4 | plasmid maintenance protein Mok | - |
| QDW60_RS24790 | 2961..3086 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QDW60_RS24795 | 3306..3536 | + | 231 | WP_074014914.1 | hypothetical protein | - |
| QDW60_RS24800 | 3534..3707 | - | 174 | Protein_7 | hypothetical protein | - |
| QDW60_RS24805 | 3777..3983 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| QDW60_RS24810 | 4008..4294 | + | 287 | Protein_9 | hypothetical protein | - |
| QDW60_RS24815 | 4413..5234 | + | 822 | WP_074014913.1 | DUF932 domain-containing protein | - |
| QDW60_RS24820 | 5531..6178 | - | 648 | WP_282953962.1 | transglycosylase SLT domain-containing protein | - |
| QDW60_RS24825 | 6455..6838 | + | 384 | WP_040073112.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QDW60_RS24830 | 7028..7714 | + | 687 | WP_000332492.1 | PAS domain-containing protein | - |
| QDW60_RS24835 | 7808..8035 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | estIa | 1..83893 | 83893 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T277571 WP_001372321.1 NZ_CP122657:2961-3086 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT277571 NZ_CP122657:c2882-2817 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|