Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4444435..4445270 | Replicon | chromosome |
| Accession | NZ_CP122655 | ||
| Organism | Escherichia coli strain ETEC4074 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QDW60_RS22125 | Protein ID | WP_282953842.1 |
| Coordinates | 4444893..4445270 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDW60_RS22120 | Protein ID | WP_282953841.1 |
| Coordinates | 4444435..4444803 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW60_RS22085 (4440317) | 4440317..4440997 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QDW60_RS22090 (4441145) | 4441145..4441822 | + | 678 | WP_001097305.1 | hypothetical protein | - |
| QDW60_RS22095 (4441828) | 4441828..4442061 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| QDW60_RS22100 (4442160) | 4442160..4442978 | + | 819 | WP_001234621.1 | DUF932 domain-containing protein | - |
| QDW60_RS22105 (4443070) | 4443070..4443555 | + | 486 | WP_267837397.1 | antirestriction protein | - |
| QDW60_RS22110 (4443571) | 4443571..4444047 | + | 477 | WP_157941596.1 | RadC family protein | - |
| QDW60_RS22115 (4444134) | 4444134..4444355 | + | 222 | WP_000691818.1 | DUF987 domain-containing protein | - |
| QDW60_RS22120 (4444435) | 4444435..4444803 | + | 369 | WP_282953841.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW60_RS22125 (4444893) | 4444893..4445270 | + | 378 | WP_282953842.1 | TA system toxin CbtA family protein | Toxin |
| QDW60_RS22130 (4445267) | 4445267..4445755 | + | 489 | WP_282953843.1 | DUF5983 family protein | - |
| QDW60_RS22135 (4445767) | 4445767..4445964 | + | 198 | WP_000839249.1 | DUF957 domain-containing protein | - |
| QDW60_RS22140 (4446049) | 4446049..4446891 | + | 843 | WP_096981527.1 | DUF4942 domain-containing protein | - |
| QDW60_RS22145 (4447702) | 4447702..4449240 | + | 1539 | WP_001187177.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | htpB / vipB/tssC / vipA/tssB / iroB | 4363504..4488416 | 124912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14025.93 Da Isoelectric Point: 6.4728
>T277568 WP_282953842.1 NZ_CP122655:4444893-4445270 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13579.30 Da Isoelectric Point: 7.0366
>AT277568 WP_282953841.1 NZ_CP122655:4444435-4444803 [Escherichia coli]
VSDTFSGTTHPNDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLEIMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDTFSGTTHPNDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLEIMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|