Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49193..50025 | Replicon | chromosome |
| Accession | NZ_CP122655 | ||
| Organism | Escherichia coli strain ETEC4074 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QDW60_RS00255 | Protein ID | WP_000854753.1 |
| Coordinates | 49193..49567 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q5I3J0 |
| Locus tag | QDW60_RS00260 | Protein ID | WP_001280951.1 |
| Coordinates | 49657..50025 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW60_RS00225 (44559) | 44559..45482 | - | 924 | WP_000535963.1 | carboxylate/amino acid/amine transporter | - |
| QDW60_RS00230 (45593) | 45593..46777 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| QDW60_RS00235 (47174) | 47174..47335 | - | 162 | Protein_46 | RhuM family protein | - |
| QDW60_RS00240 (47569) | 47569..48414 | - | 846 | WP_001406222.1 | DUF4942 domain-containing protein | - |
| QDW60_RS00245 (48499) | 48499..48696 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
| QDW60_RS00250 (48708) | 48708..49196 | - | 489 | WP_001549830.1 | DUF5983 family protein | - |
| QDW60_RS00255 (49193) | 49193..49567 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QDW60_RS00260 (49657) | 49657..50025 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW60_RS00265 (50188) | 50188..50409 | - | 222 | WP_001405861.1 | DUF987 domain-containing protein | - |
| QDW60_RS00270 (50478) | 50478..50954 | - | 477 | WP_033566565.1 | RadC family protein | - |
| QDW60_RS00275 (50970) | 50970..51455 | - | 486 | WP_001469549.1 | antirestriction protein | - |
| QDW60_RS00280 (51510) | 51510..52328 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QDW60_RS00285 (52428) | 52428..52661 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| QDW60_RS00290 (52740) | 52740..53196 | - | 457 | Protein_57 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T277550 WP_000854753.1 NZ_CP122655:c49567-49193 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q5I3J0 |