Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2988596..2988816 Replicon chromosome
Accession NZ_CP122634
Organism Escherichia coli strain ETEC4085

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag QDW62_RS14915 Protein ID WP_000170965.1
Coordinates 2988709..2988816 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2988596..2988662 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW62_RS14890 2983874..2985268 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
QDW62_RS14895 2985454..2985807 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
QDW62_RS14900 2985851..2986546 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
QDW62_RS14905 2986704..2986934 - 231 WP_001146444.1 putative cation transport regulator ChaB -
QDW62_RS14910 2987204..2988304 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2988596..2988662 - 67 - - Antitoxin
QDW62_RS14915 2988709..2988816 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2989130..2989195 - 66 NuclAT_14 - -
- 2989130..2989195 - 66 NuclAT_14 - -
- 2989130..2989195 - 66 NuclAT_14 - -
- 2989130..2989195 - 66 NuclAT_14 - -
- 2989130..2989195 - 66 NuclAT_16 - -
- 2989130..2989195 - 66 NuclAT_16 - -
- 2989130..2989195 - 66 NuclAT_16 - -
- 2989130..2989195 - 66 NuclAT_16 - -
- 2989130..2989195 - 66 NuclAT_18 - -
- 2989130..2989195 - 66 NuclAT_18 - -
- 2989130..2989195 - 66 NuclAT_18 - -
- 2989130..2989195 - 66 NuclAT_18 - -
- 2989130..2989195 - 66 NuclAT_20 - -
- 2989130..2989195 - 66 NuclAT_20 - -
- 2989130..2989195 - 66 NuclAT_20 - -
- 2989130..2989195 - 66 NuclAT_20 - -
- 2989130..2989195 - 66 NuclAT_22 - -
- 2989130..2989195 - 66 NuclAT_22 - -
- 2989130..2989195 - 66 NuclAT_22 - -
- 2989130..2989195 - 66 NuclAT_22 - -
- 2989130..2989195 - 66 NuclAT_24 - -
- 2989130..2989195 - 66 NuclAT_24 - -
- 2989130..2989195 - 66 NuclAT_24 - -
- 2989130..2989195 - 66 NuclAT_24 - -
- 2989131..2989196 - 66 NuclAT_26 - -
- 2989131..2989196 - 66 NuclAT_26 - -
- 2989131..2989196 - 66 NuclAT_26 - -
- 2989131..2989196 - 66 NuclAT_26 - -
- 2989131..2989196 - 66 NuclAT_29 - -
- 2989131..2989196 - 66 NuclAT_29 - -
- 2989131..2989196 - 66 NuclAT_29 - -
- 2989131..2989196 - 66 NuclAT_29 - -
- 2989131..2989196 - 66 NuclAT_32 - -
- 2989131..2989196 - 66 NuclAT_32 - -
- 2989131..2989196 - 66 NuclAT_32 - -
- 2989131..2989196 - 66 NuclAT_32 - -
- 2989131..2989196 - 66 NuclAT_35 - -
- 2989131..2989196 - 66 NuclAT_35 - -
- 2989131..2989196 - 66 NuclAT_35 - -
- 2989131..2989196 - 66 NuclAT_35 - -
- 2989131..2989196 - 66 NuclAT_39 - -
- 2989131..2989196 - 66 NuclAT_39 - -
- 2989131..2989196 - 66 NuclAT_39 - -
- 2989131..2989196 - 66 NuclAT_39 - -
- 2989131..2989196 - 66 NuclAT_42 - -
- 2989131..2989196 - 66 NuclAT_42 - -
- 2989131..2989196 - 66 NuclAT_42 - -
- 2989131..2989196 - 66 NuclAT_42 - -
QDW62_RS14920 2989244..2989351 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2989665..2989731 - 67 NuclAT_13 - -
- 2989665..2989731 - 67 NuclAT_13 - -
- 2989665..2989731 - 67 NuclAT_13 - -
- 2989665..2989731 - 67 NuclAT_13 - -
- 2989665..2989731 - 67 NuclAT_15 - -
- 2989665..2989731 - 67 NuclAT_15 - -
- 2989665..2989731 - 67 NuclAT_15 - -
- 2989665..2989731 - 67 NuclAT_15 - -
- 2989665..2989731 - 67 NuclAT_17 - -
- 2989665..2989731 - 67 NuclAT_17 - -
- 2989665..2989731 - 67 NuclAT_17 - -
- 2989665..2989731 - 67 NuclAT_17 - -
- 2989665..2989731 - 67 NuclAT_19 - -
- 2989665..2989731 - 67 NuclAT_19 - -
- 2989665..2989731 - 67 NuclAT_19 - -
- 2989665..2989731 - 67 NuclAT_19 - -
- 2989665..2989731 - 67 NuclAT_21 - -
- 2989665..2989731 - 67 NuclAT_21 - -
- 2989665..2989731 - 67 NuclAT_21 - -
- 2989665..2989731 - 67 NuclAT_21 - -
- 2989665..2989731 - 67 NuclAT_23 - -
- 2989665..2989731 - 67 NuclAT_23 - -
- 2989665..2989731 - 67 NuclAT_23 - -
- 2989665..2989731 - 67 NuclAT_23 - -
- 2989666..2989729 - 64 NuclAT_28 - -
- 2989666..2989729 - 64 NuclAT_28 - -
- 2989666..2989729 - 64 NuclAT_28 - -
- 2989666..2989729 - 64 NuclAT_28 - -
- 2989666..2989729 - 64 NuclAT_31 - -
- 2989666..2989729 - 64 NuclAT_31 - -
- 2989666..2989729 - 64 NuclAT_31 - -
- 2989666..2989729 - 64 NuclAT_31 - -
- 2989666..2989729 - 64 NuclAT_34 - -
- 2989666..2989729 - 64 NuclAT_34 - -
- 2989666..2989729 - 64 NuclAT_34 - -
- 2989666..2989729 - 64 NuclAT_34 - -
- 2989666..2989729 - 64 NuclAT_37 - -
- 2989666..2989729 - 64 NuclAT_37 - -
- 2989666..2989729 - 64 NuclAT_37 - -
- 2989666..2989729 - 64 NuclAT_37 - -
- 2989666..2989729 - 64 NuclAT_41 - -
- 2989666..2989729 - 64 NuclAT_41 - -
- 2989666..2989729 - 64 NuclAT_41 - -
- 2989666..2989729 - 64 NuclAT_41 - -
- 2989666..2989729 - 64 NuclAT_44 - -
- 2989666..2989729 - 64 NuclAT_44 - -
- 2989666..2989729 - 64 NuclAT_44 - -
- 2989666..2989729 - 64 NuclAT_44 - -
QDW62_RS14925 2989779..2989886 + 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
QDW62_RS14930 2990033..2990887 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QDW62_RS14935 2990923..2991732 - 810 WP_001257044.1 invasion regulator SirB1 -
QDW62_RS14940 2991736..2992128 - 393 WP_000200373.1 invasion regulator SirB2 -
QDW62_RS14945 2992125..2992958 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T277453 WP_000170965.1 NZ_CP122634:2988709-2988816 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT277453 NZ_CP122634:c2988662-2988596 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCTGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References