Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4585258..4586093 | Replicon | chromosome |
| Accession | NZ_CP122600 | ||
| Organism | Escherichia coli strain ETEC6333 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E3PD61 |
| Locus tag | QDX83_RS22655 | Protein ID | WP_001094449.1 |
| Coordinates | 4585716..4586093 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A826UXU4 |
| Locus tag | QDX83_RS22650 | Protein ID | WP_024210939.1 |
| Coordinates | 4585258..4585626 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX83_RS22620 (4582041) | 4582041..4582274 | + | 234 | WP_001117561.1 | DUF905 family protein | - |
| QDX83_RS22625 (4582374) | 4582374..4583192 | + | 819 | WP_001234706.1 | DUF932 domain-containing protein | - |
| QDX83_RS22630 (4583284) | 4583284..4583769 | + | 486 | WP_000206661.1 | antirestriction protein | - |
| QDX83_RS22635 (4583784) | 4583784..4584260 | + | 477 | WP_001186710.1 | RadC family protein | - |
| QDX83_RS22640 (4584329) | 4584329..4584550 | + | 222 | WP_000692293.1 | DUF987 domain-containing protein | - |
| QDX83_RS22645 (4584564) | 4584564..4585208 | + | 645 | WP_001079776.1 | hypothetical protein | - |
| QDX83_RS22650 (4585258) | 4585258..4585626 | + | 369 | WP_024210939.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDX83_RS22655 (4585716) | 4585716..4586093 | + | 378 | WP_001094449.1 | TA system toxin CbtA family protein | Toxin |
| QDX83_RS22660 (4586090) | 4586090..4586239 | + | 150 | Protein_4437 | DUF5983 family protein | - |
| QDX83_RS22665 (4586315) | 4586315..4586512 | + | 198 | WP_087891818.1 | DUF957 domain-containing protein | - |
| QDX83_RS22670 (4586597) | 4586597..4587229 | + | 633 | Protein_4439 | DUF4942 domain-containing protein | - |
| QDX83_RS22680 (4588560) | 4588560..4588778 | + | 219 | Protein_4441 | DUF4942 domain-containing protein | - |
| QDX83_RS22685 (4588849) | 4588849..4589709 | + | 861 | WP_282953998.1 | CSS-motif domain-containing protein | - |
| QDX83_RS22690 (4589735) | 4589735..4590948 | + | 1214 | WP_162829202.1 | IS3-like element IS1203 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4558000..4601852 | 43852 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14162.00 Da Isoelectric Point: 6.6312
>T277291 WP_001094449.1 NZ_CP122600:4585716-4586093 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SSCTHSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SSCTHSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13605.35 Da Isoelectric Point: 6.4768
>AT277291 WP_024210939.1 NZ_CP122600:4585258-4585626 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PD61 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A826UXU4 |