Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3039123..3039957 | Replicon | chromosome |
| Accession | NZ_CP122600 | ||
| Organism | Escherichia coli strain ETEC6333 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A3S7R4W2 |
| Locus tag | QDX83_RS15075 | Protein ID | WP_063085447.1 |
| Coordinates | 3039123..3039500 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2J4HRK6 |
| Locus tag | QDX83_RS15080 | Protein ID | WP_001354276.1 |
| Coordinates | 3039589..3039957 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX83_RS15040 (3034826) | 3034826..3035765 | - | 940 | Protein_2948 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| QDX83_RS15050 (3036236) | 3036236..3036442 | - | 207 | Protein_2949 | DUF4942 domain-containing protein | - |
| QDX83_RS15055 (3036473) | 3036473..3038086 | - | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| QDX83_RS15060 (3038117) | 3038117..3038467 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QDX83_RS15065 (3038464) | 3038464..3038889 | - | 426 | WP_000422741.1 | transposase | - |
| QDX83_RS15070 (3038998) | 3038998..3039126 | - | 129 | Protein_2953 | DUF5983 family protein | - |
| QDX83_RS15075 (3039123) | 3039123..3039500 | - | 378 | WP_063085447.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| QDX83_RS15080 (3039589) | 3039589..3039957 | - | 369 | WP_001354276.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QDX83_RS15085 (3040214) | 3040214..3040510 | - | 297 | Protein_2956 | antirestriction protein | - |
| QDX83_RS15090 (3040479) | 3040479..3041351 | - | 873 | Protein_2957 | AIDA repeat-containing protein | - |
| QDX83_RS15095 (3041724) | 3041724..3042596 | - | 873 | WP_053271975.1 | GTPase family protein | - |
| QDX83_RS15100 (3042860) | 3042860..3044416 | + | 1557 | WP_086186061.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13908.94 Da Isoelectric Point: 8.5222
>T277285 WP_063085447.1 NZ_CP122600:c3039500-3039123 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNNTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13649.47 Da Isoelectric Point: 7.0261
>AT277285 WP_001354276.1 NZ_CP122600:c3039957-3039589 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S7R4W2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4HRK6 |