Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 624973..625772 | Replicon | chromosome |
Accession | NZ_CP122600 | ||
Organism | Escherichia coli strain ETEC6333 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | A0A3A6SBL4 |
Locus tag | QDX83_RS03025 | Protein ID | WP_062875446.1 |
Coordinates | 624973..625437 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | QDX83_RS03030 | Protein ID | WP_001307405.1 |
Coordinates | 625437..625772 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX83_RS02995 (619974) | 619974..620408 | - | 435 | WP_063086247.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
QDX83_RS03000 (620426) | 620426..621304 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
QDX83_RS03005 (621294) | 621294..622073 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
QDX83_RS03010 (622084) | 622084..622557 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
QDX83_RS03015 (622580) | 622580..623860 | - | 1281 | WP_063086249.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
QDX83_RS03020 (624109) | 624109..624918 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
QDX83_RS03025 (624973) | 624973..625437 | - | 465 | WP_062875446.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
QDX83_RS03030 (625437) | 625437..625772 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
QDX83_RS03035 (625921) | 625921..627492 | - | 1572 | WP_001273756.1 | galactarate dehydratase | - |
QDX83_RS03040 (627867) | 627867..629201 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
QDX83_RS03045 (629217) | 629217..629992 | + | 776 | Protein_595 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17844.22 Da Isoelectric Point: 9.4942
>T277271 WP_062875446.1 NZ_CP122600:c625437-624973 [Escherichia coli]
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
MDFPQRVNSWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3A6SBL4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |