Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 7563..8164 Replicon plasmid unnamed3
Accession NZ_CP122510
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name doc Uniprot ID A0A5M4JUN5
Locus tag QC806_RS25425 Protein ID WP_001216041.1
Coordinates 7784..8164 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QC806_RS25420 Protein ID WP_001190712.1
Coordinates 7563..7784 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS25375 2981..3472 + 492 WP_211007120.1 ead/Ea22-like family protein -
QC806_RS25380 3474..4247 + 774 WP_211007118.1 DUF551 domain-containing protein -
QC806_RS25385 4240..4521 + 282 WP_211007116.1 ASCH domain-containing protein -
QC806_RS25390 4514..4930 + 417 WP_134261049.1 hypothetical protein -
QC806_RS25395 4943..5236 + 294 WP_087503529.1 hypothetical protein -
QC806_RS25400 5236..5544 + 309 WP_284632210.1 hypothetical protein -
QC806_RS25405 5541..6347 + 807 WP_244608833.1 hypothetical protein -
QC806_RS25410 6726..6977 + 252 WP_032153798.1 DNA polymerase III subunit theta -
QC806_RS25415 7101..7490 + 390 WP_032153799.1 S24 family peptidase -
QC806_RS25420 7563..7784 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QC806_RS25425 7784..8164 + 381 WP_001216041.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QC806_RS25430 8200..9294 - 1095 WP_165474256.1 hypothetical protein -
QC806_RS25435 9284..10051 - 768 WP_000446290.1 hypothetical protein -
QC806_RS25440 10058..10720 - 663 WP_205842352.1 DUF2829 domain-containing protein -
QC806_RS25445 10735..11229 - 495 WP_000640903.1 dUTP diphosphatase -
QC806_RS25450 11226..11702 - 477 WP_089502554.1 hypothetical protein -
QC806_RS25455 11699..12043 - 345 WP_215417653.1 hypothetical protein -
QC806_RS25460 12117..13145 - 1029 WP_001292231.1 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..96279 96279


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13635.52 Da        Isoelectric Point: 5.6406

>T277123 WP_001216041.1 NZ_CP122510:7784-8164 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELFGSNI

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277123 WP_001190712.1 NZ_CP122510:7563-7784 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5M4JUN5

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References