Detailed information of TA system TA277122

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63721..63990
• Replicon: plasmid unnamed2
• Accession: NZ_CP122509
• Organism: Escherichia coli strain W444

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QC806_RS24995
• Protein ID: WP_001372321.1
• Coordinates: 63865..63990 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	63721..63786 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QC806_RS24960	59431..59958	+	528	WP_284632206.1	single-stranded DNA-binding protein	-
QC806_RS24965	60016..60249	+	234	WP_284632207.1	DUF905 family protein	-
QC806_RS24970	60310..62333	+	2024	Protein_74	ParB/RepB/Spo0J family partition protein	-
QC806_RS24975	62402..62836	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QC806_RS24980	62833..63595	+	763	Protein_76	plasmid SOS inhibition protein A	-
-	63564..63788	+	225	NuclAT_0	-	-
-	63564..63788	+	225	NuclAT_0	-	-
-	63564..63788	+	225	NuclAT_0	-	-
-	63564..63788	+	225	NuclAT_0	-	-
QC806_RS24985	63573..63752	-	180	WP_001309233.1	hypothetical protein	-
-	63721..63786	-	66	-	-	Antitoxin
QC806_RS24990	63774..63923	+	150	Protein_78	plasmid maintenance protein Mok	-
QC806_RS24995	63865..63990	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QC806_RS25000	64309..64605	-	297	Protein_80	hypothetical protein	-
QC806_RS25005	64905..65201	+	297	WP_001272251.1	hypothetical protein	-
QC806_RS25010	65312..66133	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QC806_RS25015	66430..67032	-	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
QC806_RS25020	67355..67738	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QC806_RS25025	67932..68603	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
QC806_RS25030	68740..68967	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR	-	1..121553	121553

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277122 WP_001372321.1 NZ_CP122509:63865-63990 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT277122 NZ_CP122509:c63786-63721 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin