Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 20940..21499 Replicon plasmid unnamed2
Accession NZ_CP122509
Organism Escherichia coli strain W444

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag QC806_RS24735 Protein ID WP_000421272.1
Coordinates 21224..21499 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag QC806_RS24730 Protein ID WP_001387467.1
Coordinates 20940..21224 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC806_RS24705 (16241) 16241..17479 - 1239 WP_000004159.1 macrolide resistance MFS transporter Mrx(A) -
QC806_RS24710 (17476) 17476..18381 - 906 WP_000219391.1 Mph(A) family macrolide 2'-phosphotransferase -
QC806_RS24715 (18503) 18503..19207 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
QC806_RS24720 (19268) 19268..19537 + 270 Protein_24 2-keto-3-deoxygluconate permease -
QC806_RS24725 (19583) 19583..20335 - 753 WP_000562172.1 IclR family transcriptional regulator -
QC806_RS24730 (20940) 20940..21224 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
QC806_RS24735 (21224) 21224..21499 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QC806_RS24740 (21605) 21605..21808 + 204 Protein_28 hypothetical protein -
QC806_RS24745 (21933) 21933..22061 - 129 Protein_29 IS481 family transposase -
QC806_RS24750 (22094) 22094..23263 - 1170 WP_001072355.1 hypothetical protein -
QC806_RS24760 (25131) 25131..25399 + 269 Protein_32 type II toxin-antitoxin system ParD family antitoxin -
QC806_RS24765 (25386) 25386..25675 + 290 Protein_33 type II toxin-antitoxin system RelE/ParE family toxin -
QC806_RS24770 (25742) 25742..25924 + 183 WP_042344623.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / rmtB / erm(B) / mph(A) / aph(3'')-Ib / aph(6)-Id / tet(A) / floR - 1..121553 121553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T277118 WP_000421272.1 NZ_CP122509:21224-21499 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT277118 WP_001387467.1 NZ_CP122509:20940-21224 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References