Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 81715..82358 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122495 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | QC807_RS26055 | Protein ID | WP_001044768.1 |
| Coordinates | 81942..82358 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | QC807_RS26050 | Protein ID | WP_001261287.1 |
| Coordinates | 81715..81945 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS26035 (77826) | 77826..78914 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
| QC807_RS26040 (78916) | 78916..79785 | + | 870 | WP_000253407.1 | hypothetical protein | - |
| QC807_RS26045 (79842) | 79842..81407 | - | 1566 | WP_000741348.1 | AAA family ATPase | - |
| QC807_RS26050 (81715) | 81715..81945 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC807_RS26055 (81942) | 81942..82358 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC807_RS26060 (82520) | 82520..84658 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
| QC807_RS26065 (85012) | 85012..85269 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| QC807_RS26070 (85269) | 85269..85858 | + | 590 | Protein_107 | hypothetical protein | - |
| QC807_RS26075 (86144) | 86144..86848 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / oqxA / oqxB / aph(3')-IIa / blaTEM-1B / blaCTX-M-55 | - | 1..95954 | 95954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T277025 WP_001044768.1 NZ_CP122495:81942-82358 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |