Detailed information of TA system TA277019

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 173967..174393
• Replicon: plasmid unnamed1
• Accession: NZ_CP122493
• Organism: Escherichia coli strain a15

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QC807_RS24820
• Protein ID: WP_001372321.1
• Coordinates: 174268..174393 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	173967..174191 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QC807_RS24765 (169343)	169343..170314	+	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-
QC807_RS24770 (170951)	170951..171120	+	170	Protein_193	hypothetical protein	-
QC807_RS24775 (171303)	171303..171383	-	81	Protein_194	hypothetical protein	-
QC807_RS24780 (171453)	171453..171659	+	207	WP_000275856.1	hypothetical protein	-
QC807_RS24785 (171685)	171685..172224	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
QC807_RS24790 (172292)	172292..172525	+	234	WP_000005990.1	DUF905 family protein	-
QC807_RS24795 (172553)	172553..172750	+	198	Protein_198	hypothetical protein	-
QC807_RS24800 (172805)	172805..173239	+	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
QC807_RS24805 (173236)	173236..173998	+	763	Protein_200	plasmid SOS inhibition protein A	-
QC807_RS24810 (173967)	173967..174155	-	189	WP_001299721.1	hypothetical protein	-
- (173967)	173967..174191	+	225	NuclAT_0	-	Antitoxin
- (173967)	173967..174191	+	225	NuclAT_0	-	Antitoxin
- (173967)	173967..174191	+	225	NuclAT_0	-	Antitoxin
- (173967)	173967..174191	+	225	NuclAT_0	-	Antitoxin
QC807_RS24815 (174177)	174177..174326	+	150	Protein_202	plasmid maintenance protein Mok	-
QC807_RS24820 (174268)	174268..174393	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QC807_RS24825 (174677)	174677..176427	-	1751	Protein_204	Tn3-like element TnAs1 family transposase	-
QC807_RS24830 (176431)	176431..176823	+	393	WP_001351729.1	isochorismatase family cysteine hydrolase	-
QC807_RS24835 (176961)	176961..177845	+	885	WP_000058717.1	EamA family transporter	-
QC807_RS24840 (177877)	177877..179076	-	1200	WP_001493765.1	tetracycline efflux MFS transporter Tet(A)	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / tet(A) / blaTEM-1B	iucA / iucB / iucC / iucD / iutA / afaC-I	1..207405	207405

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277019 WP_001372321.1 NZ_CP122493:174268-174393 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT277019 NZ_CP122493:173967-174191 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin