Detailed information of TA system TA277017

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 50707..50976
• Replicon: plasmid unnamed1
• Accession: NZ_CP122493
• Organism: Escherichia coli strain a15

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QC807_RS24110
• Protein ID: WP_001372321.1
• Coordinates: 50851..50976 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	50707..50772 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QC807_RS24075	46417..46944	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
QC807_RS24080	47002..47235	+	234	WP_000006003.1	DUF905 family protein	-
QC807_RS24085	47296..49319	+	2024	Protein_56	ParB/RepB/Spo0J family partition protein	-
QC807_RS24090	49388..49822	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QC807_RS24095	49819..50581	+	763	Protein_58	plasmid SOS inhibition protein A	-
-	50550..50774	+	225	NuclAT_1	-	-
-	50550..50774	+	225	NuclAT_1	-	-
-	50550..50774	+	225	NuclAT_1	-	-
-	50550..50774	+	225	NuclAT_1	-	-
QC807_RS24100	50559..50738	-	180	WP_001309233.1	hypothetical protein	-
-	50707..50772	-	66	-	-	Antitoxin
QC807_RS24105	50760..50909	+	150	Protein_60	plasmid maintenance protein Mok	-
QC807_RS24110	50851..50976	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QC807_RS24115	51295..51591	-	297	Protein_62	hypothetical protein	-
QC807_RS24120	51890..52186	+	297	WP_001272251.1	hypothetical protein	-
QC807_RS24125	52297..53118	+	822	WP_001234437.1	DUF932 domain-containing protein	-
QC807_RS24130	53415..54062	-	648	WP_122996316.1	transglycosylase SLT domain-containing protein	-
QC807_RS24135	54339..54722	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QC807_RS24140	54913..55599	+	687	WP_186179623.1	PAS domain-containing protein	-
QC807_RS24145	55693..55920	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / tet(A) / blaTEM-1B	iucA / iucB / iucC / iucD / iutA / afaC-I	1..207405	207405

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T277017 WP_001372321.1 NZ_CP122493:50851-50976 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT277017 NZ_CP122493:c50772-50707 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin