Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 50707..50976 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122493 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QC807_RS24110 | Protein ID | WP_001372321.1 |
| Coordinates | 50851..50976 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 50707..50772 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS24075 | 46417..46944 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| QC807_RS24080 | 47002..47235 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QC807_RS24085 | 47296..49319 | + | 2024 | Protein_56 | ParB/RepB/Spo0J family partition protein | - |
| QC807_RS24090 | 49388..49822 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| QC807_RS24095 | 49819..50581 | + | 763 | Protein_58 | plasmid SOS inhibition protein A | - |
| - | 50550..50774 | + | 225 | NuclAT_1 | - | - |
| - | 50550..50774 | + | 225 | NuclAT_1 | - | - |
| - | 50550..50774 | + | 225 | NuclAT_1 | - | - |
| - | 50550..50774 | + | 225 | NuclAT_1 | - | - |
| QC807_RS24100 | 50559..50738 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 50707..50772 | - | 66 | - | - | Antitoxin |
| QC807_RS24105 | 50760..50909 | + | 150 | Protein_60 | plasmid maintenance protein Mok | - |
| QC807_RS24110 | 50851..50976 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QC807_RS24115 | 51295..51591 | - | 297 | Protein_62 | hypothetical protein | - |
| QC807_RS24120 | 51890..52186 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| QC807_RS24125 | 52297..53118 | + | 822 | WP_001234437.1 | DUF932 domain-containing protein | - |
| QC807_RS24130 | 53415..54062 | - | 648 | WP_122996316.1 | transglycosylase SLT domain-containing protein | - |
| QC807_RS24135 | 54339..54722 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QC807_RS24140 | 54913..55599 | + | 687 | WP_186179623.1 | PAS domain-containing protein | - |
| QC807_RS24145 | 55693..55920 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / blaTEM-1B | iucA / iucB / iucC / iucD / iutA / afaC-I | 1..207405 | 207405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T277017 WP_001372321.1 NZ_CP122493:50851-50976 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT277017 NZ_CP122493:c50772-50707 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|