Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 20439..21082 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122493 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | QC807_RS23905 | Protein ID | WP_001034046.1 |
| Coordinates | 20439..20855 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | QC807_RS23910 | Protein ID | WP_097309516.1 |
| Coordinates | 20852..21082 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS23890 (15644) | 15644..16060 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| QC807_RS23895 (16057) | 16057..16287 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QC807_RS23900 (16600) | 16600..20394 | + | 3795 | WP_253180042.1 | pcar | - |
| QC807_RS23905 (20439) | 20439..20855 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QC807_RS23910 (20852) | 20852..21082 | - | 231 | WP_097309516.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QC807_RS23915 (21318) | 21318..21809 | + | 492 | WP_000528930.1 | HEPN family nuclease | - |
| QC807_RS23920 (21821) | 21821..22579 | + | 759 | WP_253180041.1 | hypothetical protein | - |
| QC807_RS23925 (22870) | 22870..24393 | + | 1524 | WP_000921251.1 | hypothetical protein | - |
| QC807_RS23930 (24428) | 24428..25552 | + | 1125 | WP_253180040.1 | hypothetical protein | - |
| QC807_RS23935 (25552) | 25552..25842 | + | 291 | WP_000648897.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / blaTEM-1B | iucA / iucB / iucC / iucD / iutA / afaC-I | 1..207405 | 207405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T277016 WP_001034046.1 NZ_CP122493:c20855-20439 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|