Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 15644..16287 Replicon plasmid unnamed1
Accession NZ_CP122493
Organism Escherichia coli strain a15

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag QC807_RS23890 Protein ID WP_001034044.1
Coordinates 15644..16060 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag QC807_RS23895 Protein ID WP_001261286.1
Coordinates 16057..16287 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QC807_RS23860 (10875) 10875..11186 - 312 WP_001259758.1 colicin V -
QC807_RS23865 (11164) 11164..11400 - 237 WP_014640552.1 colicin V immunity protein -
QC807_RS23870 (12057) 12057..12332 + 276 WP_000179213.1 IS1-like element transposase -
QC807_RS23875 (12354) 12354..12743 + 390 WP_072242766.1 IS1 family transposase -
QC807_RS23880 (12997) 12997..14019 - 1023 WP_000361402.1 helicase UvrD -
QC807_RS23885 (14004) 14004..15569 - 1566 WP_001128474.1 AAA family ATPase -
QC807_RS23890 (15644) 15644..16060 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
QC807_RS23895 (16057) 16057..16287 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QC807_RS23900 (16600) 16600..20394 + 3795 WP_253180042.1 pcar -
QC807_RS23905 (20439) 20439..20855 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
QC807_RS23910 (20852) 20852..21082 - 231 WP_097309516.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(A) / blaTEM-1B iucA / iucB / iucC / iucD / iutA / afaC-I 1..207405 207405
- flank IS/Tn - - 12396..12743 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T277015 WP_001034044.1 NZ_CP122493:c16060-15644 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT277015 WP_001261286.1 NZ_CP122493:c16287-16057 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References