Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4710446..4711048 | Replicon | chromosome |
| Accession | NZ_CP122492 | ||
| Organism | Escherichia coli strain a15 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | QC807_RS22820 | Protein ID | WP_000897305.1 |
| Coordinates | 4710737..4711048 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QC807_RS22815 | Protein ID | WP_000356397.1 |
| Coordinates | 4710446..4710736 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QC807_RS22790 (4706371) | 4706371..4707273 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| QC807_RS22795 (4707270) | 4707270..4707905 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QC807_RS22800 (4707902) | 4707902..4708831 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| QC807_RS22805 (4709161) | 4709161..4709403 | - | 243 | WP_001087409.1 | protein YiiF | - |
| QC807_RS22810 (4709623) | 4709623..4709841 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| QC807_RS22815 (4710446) | 4710446..4710736 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QC807_RS22820 (4710737) | 4710737..4711048 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| QC807_RS22825 (4711277) | 4711277..4712185 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| QC807_RS22830 (4712249) | 4712249..4713190 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QC807_RS22835 (4713235) | 4713235..4713672 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| QC807_RS22840 (4713669) | 4713669..4714541 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QC807_RS22845 (4714535) | 4714535..4715134 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| QC807_RS22850 (4715233) | 4715233..4716018 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T277013 WP_000897305.1 NZ_CP122492:c4711048-4710737 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|