Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 132739..133265 | Replicon | plasmid pPAG03 |
| Accession | NZ_CP122322 | ||
| Organism | Pantoea agglomerans pv. gypsophilae strain 824-1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | A7P62_RS22725 | Protein ID | WP_064689878.1 |
| Coordinates | 132978..133265 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8X8DPB7 |
| Locus tag | A7P62_RS22720 | Protein ID | WP_010257033.1 |
| Coordinates | 132739..132978 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A7P62_RS22705 (A7P62_22705) | 128714..129235 | + | 522 | WP_231113895.1 | DUF2268 domain-containing putative Zn-dependent protease | - |
| A7P62_RS22710 (A7P62_22710) | 129285..130301 | - | 1017 | WP_010257039.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| A7P62_RS22715 (A7P62_22715) | 130406..132379 | - | 1974 | WP_064689879.1 | methyl-accepting chemotaxis protein | - |
| A7P62_RS22720 (A7P62_22720) | 132739..132978 | + | 240 | WP_010257033.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| A7P62_RS22725 (A7P62_22725) | 132978..133265 | + | 288 | WP_064689878.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| A7P62_RS22730 (A7P62_22730) | 133310..133606 | - | 297 | WP_033770131.1 | hypothetical protein | - |
| A7P62_RS22735 (A7P62_22735) | 133808..133984 | + | 177 | WP_010257023.1 | KGG domain-containing protein | - |
| A7P62_RS22740 (A7P62_22740) | 134048..134944 | - | 897 | WP_010257019.1 | LysR family transcriptional regulator | - |
| A7P62_RS22745 (A7P62_22745) | 135147..136271 | + | 1125 | WP_081276205.1 | MFS transporter | - |
| A7P62_RS22750 (A7P62_22750) | 136340..137365 | + | 1026 | WP_010671942.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..143524 | 143524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11119.03 Da Isoelectric Point: 10.3173
>T276796 WP_064689878.1 NZ_CP122322:132978-133265 [Pantoea agglomerans pv. gypsophilae]
MTWQLEFDQRALKEWRKLGPTVREQLKKKLAECLESPRIEANKLSGMPDCYKIKLKSSGYRLVYQVIDDRVVVFVVAVVK
RERSEVYSAASRRLS
MTWQLEFDQRALKEWRKLGPTVREQLKKKLAECLESPRIEANKLSGMPDCYKIKLKSSGYRLVYQVIDDRVVVFVVAVVK
RERSEVYSAASRRLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|