Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40287..40713 | Replicon | plasmid pVP445 |
| Accession | NZ_CP121362 | ||
| Organism | Escherichia coli strain rl0044 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P9060_RS29150 | Protein ID | WP_096937776.1 |
| Coordinates | 40588..40713 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 40287..40511 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9060_RS29110 (35441) | 35441..35905 | - | 465 | Protein_38 | hypothetical protein | - |
| P9060_RS29115 (36207) | 36207..36734 | + | 528 | WP_000290797.1 | single-stranded DNA-binding protein | - |
| P9060_RS29120 (36792) | 36792..37025 | + | 234 | WP_000006015.1 | DUF905 family protein | - |
| P9060_RS29125 (37089) | 37089..39056 | + | 1968 | WP_000117157.1 | ParB/RepB/Spo0J family partition protein | - |
| P9060_RS29130 (39125) | 39125..39559 | + | 435 | WP_000845915.1 | conjugation system SOS inhibitor PsiB | - |
| P9060_RS29135 (39556) | 39556..40342 | + | 787 | Protein_43 | plasmid SOS inhibition protein A | - |
| P9060_RS29140 (40287) | 40287..40475 | - | 189 | WP_032189914.1 | hypothetical protein | - |
| - (40444) | 40444..40509 | + | 66 | NuclAT_1 | - | - |
| - (40444) | 40444..40509 | - | 66 | NuclAT_0 | - | - |
| - (40287) | 40287..40511 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (40287) | 40287..40511 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (40287) | 40287..40511 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (40287) | 40287..40511 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (40287) | 40287..40511 | - | 225 | NuclAT_0 | - | - |
| P9060_RS29145 (40497) | 40497..40646 | + | 150 | Protein_45 | plasmid maintenance protein Mok | - |
| P9060_RS29150 (40588) | 40588..40713 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P9060_RS29155 (41011) | 41011..41281 | - | 271 | Protein_47 | hypothetical protein | - |
| P9060_RS29160 (41422) | 41422..42099 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| P9060_RS29165 (42099) | 42099..42446 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| P9060_RS29170 (42466) | 42466..44037 | + | 1572 | WP_000381395.1 | IS66-like element ISCro1 family transposase | - |
| P9060_RS29175 (44067) | 44067..44546 | + | 480 | Protein_51 | DUF932 domain-containing protein | - |
| P9060_RS29180 (44849) | 44849..45356 | - | 508 | Protein_52 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T276321 WP_096937776.1 NZ_CP121362:40588-40713 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT276321 NZ_CP121362:40287-40511 [Escherichia coli]
TCACACGGATTGCCCGTGAACTGGCTGAACGACCAGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTGCCCGTGAACTGGCTGAACGACCAGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|