Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3257545..3258379 Replicon chromosome
Accession NZ_CP121356
Organism Escherichia coli strain rl0044

Toxin (Protein)


Gene name yeeV Uniprot ID W0S379
Locus tag P9060_RS16580 Protein ID WP_000854808.1
Coordinates 3257545..3257922 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag P9060_RS16585 Protein ID WP_278242731.1
Coordinates 3258011..3258379 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9060_RS16540 (3252552) 3252552..3253043 - 492 WP_001300785.1 DUF1097 domain-containing protein -
P9060_RS16545 (3253145) 3253145..3253699 - 555 WP_001001902.1 molecular chaperone YcdY -
P9060_RS16550 (3253723) 3253723..3254460 - 738 WP_000283664.1 zinc-binding phosphatase -
P9060_RS16555 (3254515) 3254515..3255453 - 939 WP_000351315.1 glyoxylate/hydroxypyruvate reductase GhrA -
P9060_RS16565 (3255924) 3255924..3256766 - 843 WP_001280436.1 DUF4942 domain-containing protein -
P9060_RS16570 (3256851) 3256851..3257048 - 198 WP_000839248.1 DUF957 domain-containing protein -
P9060_RS16575 (3257060) 3257060..3257548 - 489 WP_000761657.1 DUF5983 family protein -
P9060_RS16580 (3257545) 3257545..3257922 - 378 WP_000854808.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P9060_RS16585 (3258011) 3258011..3258379 - 369 WP_278242731.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P9060_RS16590 (3258429) 3258429..3259076 - 648 WP_000094919.1 hypothetical protein -
P9060_RS16595 (3259095) 3259095..3259316 - 222 WP_000692345.1 DUF987 domain-containing protein -
P9060_RS16600 (3259385) 3259385..3259861 - 477 WP_001186747.1 RadC family protein -
P9060_RS16605 (3259877) 3259877..3260362 - 486 WP_000214416.1 antirestriction protein -
P9060_RS16610 (3260454) 3260454..3261272 - 819 WP_001234743.1 DUF932 domain-containing protein -
P9060_RS16615 (3261365) 3261365..3261543 + 179 Protein_3258 hypothetical protein -
P9060_RS16620 (3261683) 3261683..3262096 - 414 WP_000789535.1 hypothetical protein -
P9060_RS16625 (3262366) 3262366..3262905 - 540 WP_001104020.1 DUF4339 domain-containing protein -
P9060_RS16630 (3263030) 3263030..3263203 - 174 WP_001370911.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 3248933..3260362 11429


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13909.93 Da        Isoelectric Point: 7.9085

>T276308 WP_000854808.1 NZ_CP121356:c3257922-3257545 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13795.66 Da        Isoelectric Point: 7.3219

>AT276308 WP_278242731.1 NZ_CP121356:c3258379-3258011 [Escherichia coli]
VSDSLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQALPLLMKQLELMLTSG
ELNPRHRHTVTLYARGLTCKADTLSSCGYVYLAVYPTPKMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W0S379

Antitoxin

Source ID Structure

References