Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3055931..3056151 Replicon chromosome
Accession NZ_CP121356
Organism Escherichia coli strain rl0044

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag P9060_RS15425 Protein ID WP_000170965.1
Coordinates 3056044..3056151 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3055931..3055997 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9060_RS15400 3051209..3052603 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
P9060_RS15405 3052789..3053142 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
P9060_RS15410 3053186..3053881 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
P9060_RS15415 3054039..3054269 - 231 WP_001146444.1 putative cation transport regulator ChaB -
P9060_RS15420 3054539..3055639 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 3055931..3055997 - 67 - - Antitoxin
P9060_RS15425 3056044..3056151 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3056465..3056530 - 66 NuclAT_14 - -
- 3056465..3056530 - 66 NuclAT_14 - -
- 3056465..3056530 - 66 NuclAT_14 - -
- 3056465..3056530 - 66 NuclAT_14 - -
- 3056465..3056530 - 66 NuclAT_16 - -
- 3056465..3056530 - 66 NuclAT_16 - -
- 3056465..3056530 - 66 NuclAT_16 - -
- 3056465..3056530 - 66 NuclAT_16 - -
- 3056465..3056530 - 66 NuclAT_18 - -
- 3056465..3056530 - 66 NuclAT_18 - -
- 3056465..3056530 - 66 NuclAT_18 - -
- 3056465..3056530 - 66 NuclAT_18 - -
- 3056465..3056530 - 66 NuclAT_20 - -
- 3056465..3056530 - 66 NuclAT_20 - -
- 3056465..3056530 - 66 NuclAT_20 - -
- 3056465..3056530 - 66 NuclAT_20 - -
- 3056465..3056530 - 66 NuclAT_22 - -
- 3056465..3056530 - 66 NuclAT_22 - -
- 3056465..3056530 - 66 NuclAT_22 - -
- 3056465..3056530 - 66 NuclAT_22 - -
- 3056465..3056530 - 66 NuclAT_24 - -
- 3056465..3056530 - 66 NuclAT_24 - -
- 3056465..3056530 - 66 NuclAT_24 - -
- 3056465..3056530 - 66 NuclAT_24 - -
- 3056466..3056531 - 66 NuclAT_26 - -
- 3056466..3056531 - 66 NuclAT_26 - -
- 3056466..3056531 - 66 NuclAT_26 - -
- 3056466..3056531 - 66 NuclAT_26 - -
- 3056466..3056531 - 66 NuclAT_29 - -
- 3056466..3056531 - 66 NuclAT_29 - -
- 3056466..3056531 - 66 NuclAT_29 - -
- 3056466..3056531 - 66 NuclAT_29 - -
- 3056466..3056531 - 66 NuclAT_32 - -
- 3056466..3056531 - 66 NuclAT_32 - -
- 3056466..3056531 - 66 NuclAT_32 - -
- 3056466..3056531 - 66 NuclAT_32 - -
- 3056466..3056531 - 66 NuclAT_35 - -
- 3056466..3056531 - 66 NuclAT_35 - -
- 3056466..3056531 - 66 NuclAT_35 - -
- 3056466..3056531 - 66 NuclAT_35 - -
- 3056466..3056531 - 66 NuclAT_39 - -
- 3056466..3056531 - 66 NuclAT_39 - -
- 3056466..3056531 - 66 NuclAT_39 - -
- 3056466..3056531 - 66 NuclAT_39 - -
- 3056466..3056531 - 66 NuclAT_42 - -
- 3056466..3056531 - 66 NuclAT_42 - -
- 3056466..3056531 - 66 NuclAT_42 - -
- 3056466..3056531 - 66 NuclAT_42 - -
P9060_RS15430 3056579..3056686 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3057000..3057066 - 67 NuclAT_13 - -
- 3057000..3057066 - 67 NuclAT_13 - -
- 3057000..3057066 - 67 NuclAT_13 - -
- 3057000..3057066 - 67 NuclAT_13 - -
- 3057000..3057066 - 67 NuclAT_15 - -
- 3057000..3057066 - 67 NuclAT_15 - -
- 3057000..3057066 - 67 NuclAT_15 - -
- 3057000..3057066 - 67 NuclAT_15 - -
- 3057000..3057066 - 67 NuclAT_17 - -
- 3057000..3057066 - 67 NuclAT_17 - -
- 3057000..3057066 - 67 NuclAT_17 - -
- 3057000..3057066 - 67 NuclAT_17 - -
- 3057000..3057066 - 67 NuclAT_19 - -
- 3057000..3057066 - 67 NuclAT_19 - -
- 3057000..3057066 - 67 NuclAT_19 - -
- 3057000..3057066 - 67 NuclAT_19 - -
- 3057000..3057066 - 67 NuclAT_21 - -
- 3057000..3057066 - 67 NuclAT_21 - -
- 3057000..3057066 - 67 NuclAT_21 - -
- 3057000..3057066 - 67 NuclAT_21 - -
- 3057000..3057066 - 67 NuclAT_23 - -
- 3057000..3057066 - 67 NuclAT_23 - -
- 3057000..3057066 - 67 NuclAT_23 - -
- 3057000..3057066 - 67 NuclAT_23 - -
- 3057001..3057064 - 64 NuclAT_28 - -
- 3057001..3057064 - 64 NuclAT_28 - -
- 3057001..3057064 - 64 NuclAT_28 - -
- 3057001..3057064 - 64 NuclAT_28 - -
- 3057001..3057064 - 64 NuclAT_31 - -
- 3057001..3057064 - 64 NuclAT_31 - -
- 3057001..3057064 - 64 NuclAT_31 - -
- 3057001..3057064 - 64 NuclAT_31 - -
- 3057001..3057064 - 64 NuclAT_34 - -
- 3057001..3057064 - 64 NuclAT_34 - -
- 3057001..3057064 - 64 NuclAT_34 - -
- 3057001..3057064 - 64 NuclAT_34 - -
- 3057001..3057064 - 64 NuclAT_37 - -
- 3057001..3057064 - 64 NuclAT_37 - -
- 3057001..3057064 - 64 NuclAT_37 - -
- 3057001..3057064 - 64 NuclAT_37 - -
- 3057001..3057064 - 64 NuclAT_41 - -
- 3057001..3057064 - 64 NuclAT_41 - -
- 3057001..3057064 - 64 NuclAT_41 - -
- 3057001..3057064 - 64 NuclAT_41 - -
- 3057001..3057064 - 64 NuclAT_44 - -
- 3057001..3057064 - 64 NuclAT_44 - -
- 3057001..3057064 - 64 NuclAT_44 - -
- 3057001..3057064 - 64 NuclAT_44 - -
P9060_RS15435 3057114..3057221 + 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
P9060_RS15440 3057368..3058222 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
P9060_RS15445 3058258..3059067 - 810 WP_001257044.1 invasion regulator SirB1 -
P9060_RS15450 3059071..3059463 - 393 WP_000200373.1 invasion regulator SirB2 -
P9060_RS15455 3059460..3060293 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T276306 WP_000170965.1 NZ_CP121356:3056044-3056151 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT276306 NZ_CP121356:c3055997-3055931 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCTGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References