Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1177206..1177818 | Replicon | chromosome |
| Accession | NZ_CP121354 | ||
| Organism | Mesorhizobium sp. WSM4904 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QAZ47_RS05600 | Protein ID | WP_278232798.1 |
| Coordinates | 1177206..1177502 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QAZ47_RS05605 | Protein ID | WP_278206016.1 |
| Coordinates | 1177510..1177818 (+) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAZ47_RS05575 (QAZ47_05575) | 1173417..1174190 | + | 774 | WP_278232794.1 | FadR/GntR family transcriptional regulator | - |
| QAZ47_RS05580 (QAZ47_05580) | 1174207..1175058 | + | 852 | WP_278207791.1 | 5-dehydro-4-deoxy-D-glucuronate isomerase | - |
| QAZ47_RS05585 (QAZ47_05585) | 1175055..1175822 | + | 768 | WP_278232795.1 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD | - |
| QAZ47_RS05590 (QAZ47_05590) | 1175851..1176183 | + | 333 | WP_278232796.1 | cupin domain-containing protein | - |
| QAZ47_RS05595 (QAZ47_05595) | 1176455..1177081 | - | 627 | WP_278232797.1 | LysE family translocator | - |
| QAZ47_RS05600 (QAZ47_05600) | 1177206..1177502 | + | 297 | WP_278232798.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QAZ47_RS05605 (QAZ47_05605) | 1177510..1177818 | + | 309 | WP_278206016.1 | HigA family addiction module antitoxin | Antitoxin |
| QAZ47_RS05610 (QAZ47_05610) | 1177954..1179807 | + | 1854 | WP_278232799.1 | DNA helicase RecQ | - |
| QAZ47_RS05615 (QAZ47_05615) | 1179845..1180822 | - | 978 | WP_278232800.1 | DUF1186 domain-containing protein | - |
| QAZ47_RS05620 (QAZ47_05620) | 1181071..1182204 | + | 1134 | WP_278232801.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11864.43 Da Isoelectric Point: 6.8813
>T276276 WP_278232798.1 NZ_CP121354:1177206-1177502 [Mesorhizobium sp. WSM4904]
MILGFRDEWLRAFFVDDAHSRNIPFDLELRLFRKLQMIDDAMTDPDLRVPPSNHFEKLRGNLEGFHSIRVNKQWRLVFRW
DGRRGEASDVYLDDHSYR
MILGFRDEWLRAFFVDDAHSRNIPFDLELRLFRKLQMIDDAMTDPDLRVPPSNHFEKLRGNLEGFHSIRVNKQWRLVFRW
DGRRGEASDVYLDDHSYR
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|