Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1089168..1089788 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1N06_RS05010 | Protein ID | WP_001280991.1 |
| Coordinates | 1089168..1089386 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1N06_RS05015 | Protein ID | WP_000344807.1 |
| Coordinates | 1089414..1089788 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS04970 (1084392) | 1084392..1084961 | + | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
| P1N06_RS04975 (1084994) | 1084994..1085383 | - | 390 | WP_278208425.1 | MGMT family protein | - |
| P1N06_RS04985 (1085614) | 1085614..1087164 | - | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
| P1N06_RS04990 (1087389) | 1087389..1087650 | + | 262 | Protein_962 | type B 50S ribosomal protein L31 | - |
| P1N06_RS04995 (1087656) | 1087656..1087796 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1N06_RS05000 (1087852) | 1087852..1088322 | - | 471 | WP_080170962.1 | YlaC family protein | - |
| P1N06_RS05005 (1088438) | 1088438..1088989 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P1N06_RS05010 (1089168) | 1089168..1089386 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1N06_RS05015 (1089414) | 1089414..1089788 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1N06_RS05020 (1090284) | 1090284..1093433 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1N06_RS05025 (1093456) | 1093456..1094649 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276242 WP_001280991.1 NZ_CP121297:c1089386-1089168 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276242 WP_000344807.1 NZ_CP121297:c1089788-1089414 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|