Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 441543..442186 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B5F3H8 |
| Locus tag | P1N06_RS02015 | Protein ID | WP_000048134.1 |
| Coordinates | 441543..441959 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | P1N06_RS02020 | Protein ID | WP_001261294.1 |
| Coordinates | 441956..442186 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS01995 (436580) | 436580..437713 | + | 1134 | WP_076737649.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| P1N06_RS02000 (437697) | 437697..438815 | + | 1119 | WP_076737650.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P1N06_RS02005 (438812) | 438812..439552 | + | 741 | WP_048591337.1 | KDGP aldolase family protein | - |
| P1N06_RS02010 (439569) | 439569..441482 | + | 1914 | WP_149866235.1 | BglG family transcription antiterminator | - |
| P1N06_RS02015 (441543) | 441543..441959 | - | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1N06_RS02020 (441956) | 441956..442186 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P1N06_RS02025 (442353) | 442353..442817 | - | 465 | WP_076737652.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P1N06_RS02030 (443034) | 443034..445172 | - | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T276240 WP_000048134.1 NZ_CP121297:c441959-441543 [Salmonella enterica subsp. enterica]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T8L749 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SIC2 |