Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 43724..44478 | Replicon | chromosome |
| Accession | NZ_CP121297 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 1762 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | P1N06_RS00215 | Protein ID | WP_000558166.1 |
| Coordinates | 44167..44478 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P1N06_RS00210 | Protein ID | WP_001259009.1 |
| Coordinates | 43724..44170 (-) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1N06_RS00180 (38900) | 38900..39796 | + | 897 | WP_071055644.1 | sugar kinase | - |
| P1N06_RS00185 (39830) | 39830..40633 | + | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P1N06_RS00190 (40824) | 40824..41423 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| P1N06_RS00195 (41417) | 41417..42289 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P1N06_RS00200 (42286) | 42286..42723 | + | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| P1N06_RS00205 (42768) | 42768..43709 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P1N06_RS00210 (43724) | 43724..44170 | - | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| P1N06_RS00215 (44167) | 44167..44478 | - | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| P1N06_RS00220 (44564) | 44564..45493 | - | 930 | WP_076737573.1 | alpha/beta hydrolase | - |
| P1N06_RS00225 (45711) | 45711..46022 | + | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| P1N06_RS00230 (46023) | 46023..46313 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| P1N06_RS00235 (46360) | 46360..47289 | - | 930 | WP_076737574.1 | formate dehydrogenase accessory protein FdhE | - |
| P1N06_RS00240 (47286) | 47286..47921 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P1N06_RS00245 (47918) | 47918..48820 | - | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T276237 WP_000558166.1 NZ_CP121297:c44478-44167 [Salmonella enterica subsp. enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT276237 WP_001259009.1 NZ_CP121297:c44170-43724 [Salmonella enterica subsp. enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|