Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 4482689..4482914 Replicon chromosome
Accession NZ_CP121223
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag P5F89_RS24625 Protein ID WP_000813254.1
Coordinates 4482689..4482844 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 4482856..4482914 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS24580 4478108..4478458 + 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -
P5F89_RS24585 4478455..4478952 + 498 Protein_4381 IS66 family transposase zinc-finger binding domain-containing protein -
P5F89_RS24590 4479008..4479705 + 698 WP_223368647.1 IS1 family transposase -
P5F89_RS24605 4480132..4480820 - 689 Protein_4383 bacteriophage antitermination protein Q -
P5F89_RS24610 4480817..4481182 - 366 WP_000140020.1 RusA family crossover junction endodeoxyribonuclease -
P5F89_RS24615 4481183..4482241 - 1059 WP_001265248.1 DUF968 domain-containing protein -
P5F89_RS24620 4482243..4482521 - 279 WP_011069426.1 hypothetical protein -
P5F89_RS24625 4482689..4482844 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 4482856..4482914 + 59 - - Antitoxin
P5F89_RS24630 4483496..4483912 - 417 WP_005069274.1 hypothetical protein -
P5F89_RS24635 4483939..4484079 + 141 Protein_4389 DUF4224 domain-containing protein -
P5F89_RS24640 4484079..4485129 + 1051 Protein_4390 tyrosine-type recombinase/integrase -
P5F89_RS24650 4485340..4486137 + 798 WP_001325918.1 DgsA anti-repressor MtfA -
P5F89_RS24660 4486475..4487737 + 1263 Protein_4392 tyrosine-type recombinase/integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 4456999..4521744 64745


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T276105 WP_000813254.1 NZ_CP121223:c4482844-4482689 [Shigella flexneri 2a]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT276105 NZ_CP121223:4482856-4482914 [Shigella flexneri 2a]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References