Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34262..34495 | Replicon | plasmid pE50-1 |
| Accession | NZ_CP121200 | ||
| Organism | Escherichia coli strain E50 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | P6H83_RS23950 | Protein ID | WP_001372321.1 |
| Coordinates | 34370..34495 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 34262..34293 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H83_RS23920 (29448) | 29448..31406 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| P6H83_RS23925 (31461) | 31461..31895 | + | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
| P6H83_RS23930 (31892) | 31892..32654 | + | 763 | Protein_38 | plasmid SOS inhibition protein A | - |
| P6H83_RS23935 (32623) | 32623..32811 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (32623) | 32623..32820 | + | 198 | NuclAT_0 | - | - |
| - (32623) | 32623..32820 | + | 198 | NuclAT_0 | - | - |
| - (32623) | 32623..32820 | + | 198 | NuclAT_0 | - | - |
| - (32623) | 32623..32820 | + | 198 | NuclAT_0 | - | - |
| P6H83_RS23940 (32868) | 32868..34237 | + | 1370 | WP_087522250.1 | IS3-like element IS150 family transposase | - |
| - (34262) | 34262..34293 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (34262) | 34262..34293 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (34262) | 34262..34293 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (34262) | 34262..34293 | + | 32 | NuclAT_1 | - | Antitoxin |
| P6H83_RS23945 (34279) | 34279..34428 | + | 150 | Protein_41 | plasmid maintenance protein Mok | - |
| P6H83_RS23950 (34370) | 34370..34495 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| P6H83_RS23955 (34715) | 34715..34945 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| P6H83_RS23960 (34943) | 34943..35116 | - | 174 | Protein_44 | hypothetical protein | - |
| P6H83_RS23965 (35186) | 35186..35392 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| P6H83_RS23970 (35417) | 35417..35704 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| P6H83_RS23975 (35825) | 35825..36646 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| P6H83_RS23980 (36943) | 36943..37590 | - | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
| P6H83_RS23985 (37867) | 37867..38250 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| P6H83_RS23990 (38441) | 38441..39127 | + | 687 | WP_000332484.1 | PAS domain-containing protein | - |
| P6H83_RS23995 (39221) | 39221..39448 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / dfrA14 / blaCTX-M-27 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aph(3')-Ia / tet(A) | - | 1..124410 | 124410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T276056 WP_001372321.1 NZ_CP121200:34370-34495 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 32 bp
>AT276056 NZ_CP121200:34262-34293 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
