Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 60930..61452 Replicon plasmid pE47-1
Accession NZ_CP121152
Organism Escherichia coli strain E47

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag P6H31_RS26425 Protein ID WP_000220560.1
Coordinates 61171..61452 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag P6H31_RS26420 Protein ID WP_000121743.1
Coordinates 60930..61181 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H31_RS26390 (56289) 56289..56519 + 231 WP_000051064.1 plasmid partition protein ParG -
P6H31_RS26395 (56535) 56535..56832 + 298 Protein_82 CopG family transcriptional regulator -
P6H31_RS26400 (56834) 56834..57802 + 969 WP_278014712.1 IS5-like element IS903B family transposase -
P6H31_RS26405 (57862) 57862..58215 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
P6H31_RS26410 (58352) 58352..58798 - 447 WP_001074386.1 hypothetical protein -
P6H31_RS26415 (58838) 58838..59674 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
P6H31_RS26420 (60930) 60930..61181 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
P6H31_RS26425 (61171) 61171..61452 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P6H31_RS26430 (61598) 61598..61921 + 324 WP_001181903.1 hypothetical protein -
P6H31_RS26435 (61966) 61966..62211 + 246 WP_000356546.1 hypothetical protein -
P6H31_RS26440 (62201) 62201..62416 + 216 WP_001180116.1 hypothetical protein -
P6H31_RS26445 (62509) 62509..62838 + 330 WP_000866648.1 hypothetical protein -
P6H31_RS26450 (63125) 63125..63274 + 150 WP_000003880.1 hypothetical protein -
P6H31_RS26455 (63287) 63287..63559 + 273 WP_000160399.1 hypothetical protein -
P6H31_RS26460 (63886) 63886..64431 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
P6H31_RS26465 (64434) 64434..65591 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
P6H31_RS26470 (65952) 65952..66443 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / floR / aph(3')-Ia / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / qnrS2 vat 1..142233 142233
- flank IS/Tn - - 56834..57802 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T275921 WP_000220560.1 NZ_CP121152:61171-61452 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT275921 WP_000121743.1 NZ_CP121152:60930-61181 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References