Detailed information of TA system TA275919

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 25081..25507
• Replicon: plasmid pE47-1
• Accession: NZ_CP121152
• Organism: Escherichia coli strain E47

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: P6H31_RS26175
• Protein ID: WP_001372321.1
• Coordinates: 25382..25507 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	25081..25305 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P6H31_RS26130 (20128)	20128..20388	+	261	WP_021536188.1	hypothetical protein	-
P6H31_RS26135 (20280)	20280..20558	+	279	WP_072127934.1	hypothetical protein	-
P6H31_RS26140 (21031)	21031..21558	+	528	WP_278014709.1	single-stranded DNA-binding protein	-
P6H31_RS26145 (21614)	21614..21847	+	234	WP_000006004.1	DUF905 domain-containing protein	-
P6H31_RS26150 (21906)	21906..23864	+	1959	WP_278014710.1	ParB/RepB/Spo0J family partition protein	-
P6H31_RS26155 (23919)	23919..24353	+	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
P6H31_RS26160 (24350)	24350..25112	+	763	Protein_35	plasmid SOS inhibition protein A	-
P6H31_RS26165 (25081)	25081..25269	-	189	WP_001299721.1	hypothetical protein	-
- (25081)	25081..25305	+	225	NuclAT_0	-	Antitoxin
- (25081)	25081..25305	+	225	NuclAT_0	-	Antitoxin
- (25081)	25081..25305	+	225	NuclAT_0	-	Antitoxin
- (25081)	25081..25305	+	225	NuclAT_0	-	Antitoxin
P6H31_RS26170 (25291)	25291..25440	+	150	Protein_37	plasmid maintenance protein Mok	-
P6H31_RS26175 (25382)	25382..25507	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
P6H31_RS26180 (25727)	25727..25957	+	231	WP_001426396.1	hypothetical protein	-
P6H31_RS26185 (25955)	25955..26128	-	174	Protein_40	hypothetical protein	-
P6H31_RS26190 (26283)	26283..26570	+	288	WP_000107535.1	hypothetical protein	-
P6H31_RS26195 (26693)	26693..27514	+	822	WP_001234469.1	DUF932 domain-containing protein	-
P6H31_RS26200 (27811)	27811..28413	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
P6H31_RS26205 (28734)	28734..29117	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
P6H31_RS26210 (29304)	29304..29993	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
P6H31_RS26215 (30086)	30086..30487	+	402	WP_001369361.1	conjugal transfer relaxosome DNA-bindin protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD / floR / aph(3')-Ia / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / qnrS2	vat	1..142233	142233

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T275919 WP_001372321.1 NZ_CP121152:25382-25507 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT275919 NZ_CP121152:25081-25305 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin