Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3201937..3202772 Replicon chromosome
Accession NZ_CP121151
Organism Escherichia coli strain E47

Toxin (Protein)


Gene name yeeV Uniprot ID A0A6H2GFM1
Locus tag P6H31_RS16055 Protein ID WP_065304416.1
Coordinates 3201937..3202314 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A6H2GGB7
Locus tag P6H31_RS16060 Protein ID WP_001285390.1
Coordinates 3202404..3202772 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6H31_RS16015 (3197207) 3197207..3197698 - 492 WP_001297187.1 DUF1097 domain-containing protein -
P6H31_RS16020 (3197800) 3197800..3198354 - 555 WP_001001902.1 molecular chaperone YcdY -
P6H31_RS16025 (3198378) 3198378..3199115 - 738 WP_000283664.1 zinc-binding phosphatase -
P6H31_RS16030 (3199170) 3199170..3200108 - 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
P6H31_RS16040 (3200579) 3200579..3201421 - 843 WP_065304417.1 DUF4942 domain-containing protein -
P6H31_RS16045 (3201518) 3201518..3201715 - 198 WP_086598277.1 DUF957 domain-containing protein -
P6H31_RS16050 (3201791) 3201791..3201940 - 150 Protein_3152 DUF5983 family protein -
P6H31_RS16055 (3201937) 3201937..3202314 - 378 WP_065304416.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P6H31_RS16060 (3202404) 3202404..3202772 - 369 WP_001285390.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6H31_RS16065 (3202822) 3202822..3203466 - 645 WP_065304415.1 antitoxin of toxin-antitoxin stability system -
P6H31_RS16070 (3203481) 3203481..3203702 - 222 WP_000692312.1 DUF987 domain-containing protein -
P6H31_RS16075 (3203771) 3203771..3204247 - 477 WP_001186747.1 RadC family protein -
P6H31_RS16080 (3204262) 3204262..3204747 - 486 WP_000214317.1 antirestriction protein -
P6H31_RS16085 (3204838) 3204838..3205659 - 822 WP_106668205.1 DUF932 domain-containing protein -
P6H31_RS16090 (3205880) 3205880..3206290 - 411 WP_000846713.1 hypothetical protein -
P6H31_RS16095 (3206306) 3206306..3206983 - 678 WP_059239983.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 3193589..3224438 30849


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14060.06 Da        Isoelectric Point: 7.8522

>T275912 WP_065304416.1 NZ_CP121151:c3202314-3201937 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.52 Da        Isoelectric Point: 5.9618

>AT275912 WP_001285390.1 NZ_CP121151:c3202772-3202404 [Escherichia coli]
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6H2GFM1

Antitoxin

Source ID Structure
AlphaFold DB A0A6H2GGB7

References