Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 870738..871392 | Replicon | chromosome |
| Accession | NZ_CP121151 | ||
| Organism | Escherichia coli strain E47 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | P6H31_RS04300 | Protein ID | WP_000244772.1 |
| Coordinates | 870985..871392 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | P6H31_RS04295 | Protein ID | WP_000354046.1 |
| Coordinates | 870738..871004 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H31_RS04270 (866026) | 866026..866769 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| P6H31_RS04275 (866826) | 866826..868259 | - | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| P6H31_RS04280 (868304) | 868304..868615 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| P6H31_RS04285 (868779) | 868779..869438 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| P6H31_RS04290 (869515) | 869515..870495 | - | 981 | WP_096857157.1 | tRNA-modifying protein YgfZ | - |
| P6H31_RS04295 (870738) | 870738..871004 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| P6H31_RS04300 (870985) | 870985..871392 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| P6H31_RS04305 (871432) | 871432..871953 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| P6H31_RS04310 (872065) | 872065..872961 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| P6H31_RS04315 (872986) | 872986..873696 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P6H31_RS04320 (873702) | 873702..875435 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T275900 WP_000244772.1 NZ_CP121151:870985-871392 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |