Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3411420..3412040 | Replicon | chromosome |
Accession | NZ_CP121003 | ||
Organism | Salmonella enterica strain 31A |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P6590_RS16810 | Protein ID | WP_001280991.1 |
Coordinates | 3411822..3412040 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P6590_RS16805 | Protein ID | WP_000344807.1 |
Coordinates | 3411420..3411794 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6590_RS16795 (3406559) | 3406559..3407752 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P6590_RS16800 (3407775) | 3407775..3410924 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P6590_RS16805 (3411420) | 3411420..3411794 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P6590_RS16810 (3411822) | 3411822..3412040 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P6590_RS16815 (3412219) | 3412219..3412770 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P6590_RS16820 (3412888) | 3412888..3413358 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P6590_RS16825 (3413414) | 3413414..3413554 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P6590_RS16830 (3413560) | 3413560..3413820 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P6590_RS16835 (3414045) | 3414045..3415595 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P6590_RS16845 (3415826) | 3415826..3416215 | + | 390 | WP_000961287.1 | MGMT family protein | - |
P6590_RS16850 (3416248) | 3416248..3416817 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275523 WP_001280991.1 NZ_CP121003:3411822-3412040 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275523 WP_000344807.1 NZ_CP121003:3411420-3411794 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|