Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 5867439..5868256 | Replicon | chromosome |
| Accession | NZ_CP120956 | ||
| Organism | Delftia tsuruhatensis strain Ery-6A | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A1H3PAE7 |
| Locus tag | PYR84_RS26590 | Protein ID | WP_074922422.1 |
| Coordinates | 5867765..5868256 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | - |
| Locus tag | PYR84_RS26585 | Protein ID | WP_160854329.1 |
| Coordinates | 5867439..5867768 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYR84_RS26565 (PYR84_26565) | 5862989..5863822 | - | 834 | WP_074922418.1 | helix-turn-helix transcriptional regulator | - |
| PYR84_RS26570 (PYR84_26570) | 5863893..5864555 | + | 663 | WP_277849008.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| PYR84_RS26575 (PYR84_26575) | 5864583..5864978 | + | 396 | WP_277849009.1 | hypothetical protein | - |
| PYR84_RS26580 (PYR84_26580) | 5865102..5867342 | + | 2241 | WP_277849010.1 | TonB-dependent receptor | - |
| PYR84_RS26585 (PYR84_26585) | 5867439..5867768 | + | 330 | WP_160854329.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PYR84_RS26590 (PYR84_26590) | 5867765..5868256 | + | 492 | WP_074922422.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PYR84_RS26595 (PYR84_26595) | 5868271..5868783 | - | 513 | WP_016448386.1 | MgtC/SapB family protein | - |
| PYR84_RS26600 (PYR84_26600) | 5868898..5870325 | - | 1428 | WP_277849011.1 | chloride channel protein | - |
| PYR84_RS26605 (PYR84_26605) | 5870600..5870929 | - | 330 | WP_013800515.1 | DHCW motif cupin fold protein | - |
| PYR84_RS26610 (PYR84_26610) | 5870993..5871811 | - | 819 | WP_277849012.1 | precorrin-6A synthase (deacetylating) | - |
| PYR84_RS26615 (PYR84_26615) | 5871808..5872674 | - | 867 | WP_277849013.1 | precorrin-4 C(11)-methyltransferase | - |
| PYR84_RS26620 (PYR84_26620) | 5872671..5873156 | - | 486 | WP_016452700.1 | cobalamin biosynthesis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 18772.38 Da Isoelectric Point: 10.2215
>T275482 WP_074922422.1 NZ_CP120956:5867765-5868256 [Delftia tsuruhatensis]
MSAVPPAPLRIHGWTVFMHPLFLAQLQALSHEVEGLKTKDPGGYTRKNATKRLAAIRKLAFDVIPQDPTRPDYRQGHTLG
EEHKHWFRARFFQQYRLFFRFHAPSKIIVFAWVNDEDTKRAYEGSDDAYRVFRKMLANGHPPGDWDSLLAQAKSPPPDSQ
PHA
MSAVPPAPLRIHGWTVFMHPLFLAQLQALSHEVEGLKTKDPGGYTRKNATKRLAAIRKLAFDVIPQDPTRPDYRQGHTLG
EEHKHWFRARFFQQYRLFFRFHAPSKIIVFAWVNDEDTKRAYEGSDDAYRVFRKMLANGHPPGDWDSLLAQAKSPPPDSQ
PHA
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|