Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4488354..4488956 | Replicon | chromosome |
| Accession | NZ_CP120837 | ||
| Organism | Salmonella enterica subsp. enterica strain 21A | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | P4B21_RS21805 | Protein ID | WP_001159635.1 |
| Coordinates | 4488645..4488956 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P4B21_RS21800 | Protein ID | WP_000362050.1 |
| Coordinates | 4488354..4488644 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B21_RS21785 (4485847) | 4485847..4486749 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| P4B21_RS21790 (4486746) | 4486746..4487381 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| P4B21_RS21795 (4487378) | 4487378..4488307 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| P4B21_RS21800 (4488354) | 4488354..4488644 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| P4B21_RS21805 (4488645) | 4488645..4488956 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| P4B21_RS21810 (4489174) | 4489174..4490103 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| P4B21_RS21815 (4490189) | 4490189..4490500 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
| P4B21_RS21820 (4490497) | 4490497..4490943 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| P4B21_RS21825 (4490958) | 4490958..4491899 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| P4B21_RS21830 (4491944) | 4491944..4492381 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| P4B21_RS21835 (4492378) | 4492378..4493250 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| P4B21_RS21840 (4493244) | 4493244..4493843 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T275410 WP_001159635.1 NZ_CP120837:c4488956-4488645 [Salmonella enterica subsp. enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|