Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 3963064..3963765 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A515RBV3 |
| Locus tag | P6O79_RS19490 | Protein ID | WP_001531265.1 |
| Coordinates | 3963430..3963765 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | P6O79_RS19485 | Protein ID | WP_032143152.1 |
| Coordinates | 3963064..3963399 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS19460 (3959011) | 3959011..3959229 | - | 219 | WP_001531256.1 | AlpA family phage regulatory protein | - |
| P6O79_RS19465 (3959347) | 3959347..3959961 | - | 615 | WP_001531257.1 | inovirus Gp2 family protein | - |
| P6O79_RS19470 (3960554) | 3960554..3961507 | + | 954 | WP_001531259.1 | hypothetical protein | - |
| P6O79_RS19475 (3961743) | 3961743..3962561 | + | 819 | WP_001531260.1 | DUF932 domain-containing protein | - |
| P6O79_RS19480 (3962591) | 3962591..3963064 | + | 474 | WP_001531261.1 | DNA repair protein RadC | - |
| P6O79_RS19485 (3963064) | 3963064..3963399 | + | 336 | WP_032143152.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6O79_RS19490 (3963430) | 3963430..3963765 | + | 336 | WP_001531265.1 | TA system toxin CbtA family protein | Toxin |
| P6O79_RS19495 (3963896) | 3963896..3964729 | + | 834 | WP_001531266.1 | DUF4942 domain-containing protein | - |
| P6O79_RS19500 (3964806) | 3964806..3965054 | + | 249 | WP_024187601.1 | ribbon-helix-helix domain-containing protein | - |
| P6O79_RS19505 (3965058) | 3965058..3965333 | + | 276 | WP_001531268.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P6O79_RS19510 (3965447) | 3965447..3966244 | + | 798 | WP_001531269.1 | helix-turn-helix transcriptional regulator | - |
| P6O79_RS19515 (3966655) | 3966655..3966826 | + | 172 | Protein_3815 | integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12867.89 Da Isoelectric Point: 9.8953
>T275305 WP_001531265.1 NZ_CP120633:3963430-3963765 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQILLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRRHNTP
MKIIPATTLRATTSYLSPVVVWQILLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWQEQTPYLRAVDILRARQATGLLRRRHNTP
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|