Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1264630..1265461 Replicon chromosome
Accession NZ_CP120633
Organism Escherichia coli strain USVAST219

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag P6O79_RS06695 Protein ID WP_000854815.1
Coordinates 1265087..1265461 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag P6O79_RS06690 Protein ID WP_001280918.1
Coordinates 1264630..1264998 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6O79_RS06650 (1260221) 1260221..1260898 + 678 WP_001362823.1 hypothetical protein -
P6O79_RS06655 (1260914) 1260914..1261324 + 411 WP_000846703.1 hypothetical protein -
P6O79_RS06660 (1261545) 1261545..1262363 + 819 WP_001542275.1 DUF932 domain-containing protein -
P6O79_RS06665 (1262363) 1262363..1262608 + 246 WP_001164966.1 hypothetical protein -
P6O79_RS06670 (1262702) 1262702..1263175 + 474 WP_001542276.1 antirestriction protein -
P6O79_RS06675 (1263191) 1263191..1263667 + 477 WP_001186200.1 RadC family protein -
P6O79_RS06680 (1263730) 1263730..1263951 + 222 WP_000692345.1 DUF987 domain-containing protein -
P6O79_RS06685 (1263970) 1263970..1264614 + 645 WP_000086752.1 hypothetical protein -
P6O79_RS06690 (1264630) 1264630..1264998 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6O79_RS06695 (1265087) 1265087..1265461 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P6O79_RS06700 (1265458) 1265458..1265652 + 195 WP_000988600.1 DUF5983 family protein -
P6O79_RS06705 (1265698) 1265698..1265778 + 81 Protein_1322 hypothetical protein -
P6O79_RS06710 (1266067) 1266067..1266213 - 147 Protein_1323 transposase domain-containing protein -
P6O79_RS06715 (1266315) 1266315..1266449 + 135 WP_059338447.1 EutP/PduV family microcompartment system protein -
P6O79_RS06720 (1266550) 1266550..1266879 - 330 WP_000450409.1 DUF496 family protein -
P6O79_RS06725 (1267051) 1267051..1268109 - 1059 WP_001200889.1 FUSC family protein -
P6O79_RS06730 (1268307) 1268307..1268780 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
P6O79_RS06735 (1268899) 1268899..1270065 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T275295 WP_000854815.1 NZ_CP120633:1265087-1265461 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT275295 WP_001280918.1 NZ_CP120633:1264630-1264998 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References