Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2572960..2573596 | Replicon | chromosome |
| Accession | NZ_CP120608 | ||
| Organism | Priestia megaterium strain DSM 32 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | P5650_RS15990 | Protein ID | WP_013055004.1 |
| Coordinates | 2573246..2573596 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | P5650_RS15985 | Protein ID | WP_013055003.1 |
| Coordinates | 2572960..2573241 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5650_RS15960 (P5650_15950) | 2568326..2569297 | + | 972 | WP_034654859.1 | UV DNA damage repair endonuclease UvsE | - |
| P5650_RS15965 (P5650_15955) | 2569306..2569908 | - | 603 | WP_034654858.1 | rhomboid family intramembrane serine protease | - |
| P5650_RS15970 (P5650_15960) | 2569973..2570338 | + | 366 | WP_025753519.1 | holo-ACP synthase | - |
| P5650_RS15975 (P5650_15965) | 2570397..2571455 | + | 1059 | WP_016762756.1 | outer membrane lipoprotein carrier protein LolA | - |
| P5650_RS15980 (P5650_15970) | 2571569..2572759 | + | 1191 | WP_034654856.1 | alanine racemase | - |
| P5650_RS15985 (P5650_15975) | 2572960..2573241 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| P5650_RS15990 (P5650_15980) | 2573246..2573596 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P5650_RS15995 (P5650_15985) | 2573756..2574592 | + | 837 | WP_034654854.1 | RsbT co-antagonist protein RsbRA | - |
| P5650_RS16000 (P5650_15990) | 2574595..2574951 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| P5650_RS16005 (P5650_15995) | 2574955..2575356 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| P5650_RS16010 (P5650_16000) | 2575370..2576380 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
| P5650_RS16015 (P5650_16005) | 2576440..2576772 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| P5650_RS16020 (P5650_16010) | 2576769..2577254 | + | 486 | WP_016762758.1 | anti-sigma B factor RsbW | - |
| P5650_RS16025 (P5650_16015) | 2577220..2578014 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T275246 WP_013055004.1 NZ_CP120608:2573246-2573596 [Priestia megaterium]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|