Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2477108..2477940 Replicon chromosome
Accession NZ_CP120557
Organism Escherichia coli strain B771

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag P5709_RS12310 Protein ID WP_000854753.1
Coordinates 2477566..2477940 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag P5709_RS12305 Protein ID WP_001278232.1
Coordinates 2477108..2477476 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5709_RS12270 (2472951) 2472951..2473631 + 681 WP_001593697.1 WYL domain-containing protein -
P5709_RS12275 (2473779) 2473779..2474456 + 678 WP_001097305.1 hypothetical protein -
P5709_RS12280 (2474462) 2474462..2474695 + 234 WP_001278287.1 DUF905 family protein -
P5709_RS12285 (2474794) 2474794..2475612 + 819 WP_001234629.1 DUF932 domain-containing protein -
P5709_RS12290 (2475694) 2475694..2476173 + 480 WP_016247864.1 antirestriction protein -
P5709_RS12295 (2476185) 2476185..2476661 + 477 WP_001186710.1 RadC family protein -
P5709_RS12300 (2476724) 2476724..2476945 + 222 WP_000692303.1 DUF987 domain-containing protein -
P5709_RS12305 (2477108) 2477108..2477476 + 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
P5709_RS12310 (2477566) 2477566..2477940 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
P5709_RS12315 (2477937) 2477937..2478425 + 489 WP_000777541.1 DUF5983 family protein -
P5709_RS12320 (2478437) 2478437..2478634 + 198 WP_000839281.1 DUF957 domain-containing protein -
P5709_RS12325 (2478731) 2478731..2479300 + 570 WP_001290247.1 DUF4942 domain-containing protein -
P5709_RS12330 (2479643) 2479643..2479813 + 171 Protein_2423 IS110 family transposase -
P5709_RS12335 (2480612) 2480612..2481595 + 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
P5709_RS12340 (2481667) 2481667..2482815 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2479709..2479813 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T275134 WP_000854753.1 NZ_CP120557:2477566-2477940 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT275134 WP_001278232.1 NZ_CP120557:2477108-2477476 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References