Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4006316..4006832 | Replicon | chromosome |
| Accession | NZ_CP120393 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1698-2017_CO_06 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PVA83_RS19705 | Protein ID | WP_000220578.1 |
| Coordinates | 4006316..4006600 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PVA83_RS19710 | Protein ID | WP_000212724.1 |
| Coordinates | 4006590..4006832 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA83_RS19690 (PVA83_19685) | 4001528..4003180 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
| PVA83_RS19695 (PVA83_19690) | 4003589..4005727 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PVA83_RS19700 (PVA83_19695) | 4005848..4006312 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PVA83_RS19705 (PVA83_19700) | 4006316..4006600 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVA83_RS19710 (PVA83_19705) | 4006590..4006832 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PVA83_RS19715 (PVA83_19710) | 4006910..4008823 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
| PVA83_RS19720 (PVA83_19715) | 4008840..4009580 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
| PVA83_RS19725 (PVA83_19720) | 4009577..4010695 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PVA83_RS19730 (PVA83_19725) | 4010679..4011812 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274968 WP_000220578.1 NZ_CP120393:c4006600-4006316 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |